AMAB91170

Monoclonal Anti-LAMP1 antibody produced in mouse

Prestige Antibodies^® Powered by Atlas Antibodies, clone CL3484, purified immunoglobulin, buffered aqueous glycerol solution

• Sinónimos: Anti-CD107a
• Código UNSPSC: 12352203
• NACRES: NA.41

Propiedades

• origen biológico: mouse
• Nivel de calidad: 100
• conjugado: unconjugated
• forma del anticuerpo: purified immunoglobulin
• tipo de anticuerpo: primary antibodies
• clon: CL3484, monoclonal
• Línea del producto: Prestige Antibodies^® Powered by Atlas Antibodies
• formulario: buffered aqueous glycerol solution
• reactividad de especies: human
• técnicas: immunoblotting: 1 μg/mL; immunohistochemistry: 1:5000- 1:10000
• isotipo: IgG2a
• secuencia del inmunógeno: NFSAAFSVNYDTKSGPKNMTFDLPSDATVVLNRSSCGKENTSDPSLVIAFGRGHTLTLNFTRNATRYSVQLMSFVYNLSDTHLFPNASSKEIKTVESITDIRADIDKKYRCVSGTQVHMNNVTVTLHDA
• Nº de acceso UniProt: P11279
• Condiciones de envío: wet ice
• temp. de almacenamiento: −20°C
• modificación del objetivo postraduccional: unmodified
• Información sobre el gen: human ... LAMP1(3916)

Descripción

Descripción general

The gene LAMP1 (lysosomal-associated membrane protein 1) encodes a type I transmembrane protein has a short cytoplasmic tail containing a lysosome-targeting signal of GYQTI(382)-COOH. The gene is mapped to human chromosome 13q34.

Inmunógeno

lysosomal-associated membrane protein 1

Aplicación

All Prestige Antibodies^® Powered by Atlas Antibodies is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies^® protocols and other useful information.

Acciones bioquímicas o fisiológicas

The gene LAMP1 (lysosomal associated membrane protein 1) encodes a membrane glycoprotein that functions as an intracellular receptor. It is found to be expressed in the cytoplasm of several types of tumor cells and may be involved in tumor invasion. Lamp1 is crucial for perforin trafficking to the lytic granules and motility of these lytic granules. Its knockdown leads to inhibition of cytotoxicity of human natural killer cells.

Características y beneficios

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Ligadura / enlace

Corresponding Antigen APREST93498

Forma física

Phospate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Información legal

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Información de seguridad

• Código de clase de almacenamiento: 10 - Combustible liquids
• Clase de riesgo para el agua (WGK): WGK 1
• Punto de inflamabilidad (°F): Not applicable
• Punto de inflamabilidad (°C): Not applicable