374090
Anti-Heme Oxygenase-1 (1-30) Rabbit pAb
liquid, Calbiochem®
Sinónimos:
Anti-HO-1, Anti-Hsp32
Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización
About This Item
Código UNSPSC:
12352203
NACRES:
NA.41
Productos recomendados
origen biológico
rabbit
Nivel de calidad
forma del anticuerpo
purified antibody
tipo de anticuerpo
primary antibodies
clon
polyclonal
formulario
liquid
contiene
≤0.1% sodium azide as preservative
reactividad de especies
human, hamster, monkey, mouse, rat, canine
fabricante / nombre comercial
Calbiochem®
condiciones de almacenamiento
OK to freeze
avoid repeated freeze/thaw cycles
isotipo
IgG
Condiciones de envío
ambient
temp. de almacenamiento
−20°C
modificación del objetivo postraduccional
unmodified
Información sobre el gen
human ... HMOX1(3162)
Descripción general
Anti-Heme Oxygenase-1 (1-30), rabbit polyclonal, recognizes the ~32 kDa HO-1 protein. Does not cross-react with HO-2. It is validated for use in Western blotting and immunoprecipitation.
Protein A purified rabbit polyclonal antibody. Recognizes the ~32 kDa HO-1 protein.
Recognizes the ~32 kDa HO-1 protein. Does not cross-react with HO-2.
Inmunógeno
Human
a synthetic peptide (MERPQPDSMPQDLSEALKEATKEVHTQAEN) corresponding to amino acids 1-30 of human HO-1 prepared as a four-branched multiple antigen peptide
Aplicación
Immunoblotting (1:1000, chemiluminescence)
Immunoprecipitation (1:100)
Immunoprecipitation (1:100)
Advertencia
Toxicity: Standard Handling (A)
Forma física
In PBS, 50% glycerol, pH 7.2.
Reconstitución
Following initial thaw, aliquot and freeze (-20°C).
Otras notas
Does not cross-react with HO-2. Variables associated with assay conditions will dictate the proper working dilution.
Maines, M.D. 1988 FASEB J.2, 2557.
Kutty, R.K., et al. 1994. J. Cell Physiol.159, 371.
Yoshida, T., et al. 1988. Eur. J. Biochem. 171, 457.
Trakshel, G.M., et al. 1986 J. Biol. Chem.261, 11131.
Kutty, R.K., et al. 1994. J. Cell Physiol.159, 371.
Yoshida, T., et al. 1988. Eur. J. Biochem. 171, 457.
Trakshel, G.M., et al. 1986 J. Biol. Chem.261, 11131.
Información legal
CALBIOCHEM is a registered trademark of Merck KGaA, Darmstadt, Germany
Not finding the right product?
Try our Herramienta de selección de productos.
Código de clase de almacenamiento
10 - Combustible liquids
Clase de riesgo para el agua (WGK)
WGK 1
Certificados de análisis (COA)
Busque Certificados de análisis (COA) introduciendo el número de lote del producto. Los números de lote se encuentran en la etiqueta del producto después de las palabras «Lot» o «Batch»
¿Ya tiene este producto?
Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.
Jin-Woo Jeong et al.
Foods (Basel, Switzerland), 8(8) (2019-07-31)
Sea tangle (Laminaria japonica Aresch), a brown alga, has been used for many years as a functional food ingredient in the Asia-Pacific region. In the present study, we investigated the effects of fermented sea tangle extract (FST) on receptor activator
Da Hye Kwon et al.
International journal of molecular medicine, 41(1), 264-274 (2017-11-09)
Schisandrin A is a bioactive lignan occurring in the fruits of plants of the Schisandra genus that have traditionally been used in Korea for treating various inflammatory diseases. Although the anti-inflammatory and antioxidant effects of lignan analogues similar to schisandrin A have
Dong-Sung Lee et al.
Molecular medicine reports, 15(1), 451-459 (2016-12-14)
Liver diseases are considered to be primary contributors to morbidity and mortality rates in humans. Oxidative stress is critical in liver injury, and oxidant‑induced liver injury may be caused by toxins, including tert‑butyl hydroperoxide (t‑BHP). The present study investigated the
Seon Yeong Ji et al.
Biomolecules & therapeutics, 29(6), 685-696 (2021-04-07)
In this study, we investigated the inhibitory effect of 5-aminolevulinic acid (ALA), a heme precursor, on inflammatory and oxidative stress activated by lipopolysaccharide (LPS) in RAW 264.7 macrophages by estimating nitric oxide (NO), prostaglandin E2 (PGE2), cytokines, and reactive oxygen
Yun-Ta Liu et al.
Nutrients, 12(2) (2020-02-23)
14-Deoxy-11,12-didehydroandrographolide (deAND), a diterpenoid in Andrographis paniculata (Burm. f.) Nees, acts as a bioactive phytonutrient that can treat many diseases. To investigate the protective effects of deAND on reducing fatty liver disease, male mice were fed a high-fat and high-cholesterol
Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.
Póngase en contacto con el Servicio técnico