Skip to Content
Merck
All Photos(4)

Key Documents

WH0388677M1

Sigma-Aldrich

Monoclonal Anti-NOTCH2NL antibody produced in mouse

clone 2G12-2A5, purified immunoglobulin, buffered aqueous solution

Synonym(s):

Anti-N2N, Anti-Notch homolog 2 (Drosophila) N-terminal like

Sign Into View Organizational & Contract Pricing

Select a Size

100 μG
€417.00

€417.00


Please contact Customer Service for Availability


Select a Size

Change View
100 μG
€417.00

About This Item

UNSPSC Code:
12352203
NACRES:
NA.41

€417.00


Please contact Customer Service for Availability

biological source

mouse

Quality Level

conjugate

unconjugated

antibody form

purified immunoglobulin

antibody product type

primary antibodies

clone

2G12-2A5, monoclonal

form

buffered aqueous solution

species reactivity

human

technique(s)

indirect ELISA: suitable
indirect immunofluorescence: suitable
western blot: 1-5 μg/mL

isotype

IgG1κ

GenBank accession no.

UniProt accession no.

shipped in

dry ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

General description

Notch homolog 2-N-terminal like (NOTCH2NL) is a 36kDa secreted protein. It is composed of 235 amino acids. The gene encoding it is localized on human chromosome 1 and has six exons.

Immunogen

NOTCH2NL (AAH19835, 1 a.a. ~ 236 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MCVTYHNGTGYCKCPEGFLGEYCQHRDPCEKNRCQNGGTCVAQAMLGKATCRCASGFTGEDCQYSTSHPCFVSRPCLNGGTCHMLSRDTYECTCQVGFTGKECQWTDACLSHPCANGSTCTTVANQFSCKCLTGFTGQKCETDVNECDIPGHCQHGGICLNLPGSYQCQCLQGFTGQYCDSLYVPCAPSPCVNGGTCRQTGDFTFECNCLPETVRRGTELWERDREVWNGKEHDEN

Biochem/physiol Actions

Notch homolog 2-N-terminal like (NOTCH2NL) has been shown to suppress the activities of proteins involved in the Notch pathway in vitro. It is linked to anaplastic astrocytoma.

Physical form

Solution in phosphate buffered saline, pH 7.4

Legal Information

GenBank is a registered trademark of United States Department of Health and Human Services

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

nwg

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Personal Protective Equipment

dust mask type N95 (US), Eyeshields, Gloves

Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Patrick J Killela et al.
Oncotarget, 5(6), 1452-1457 (2013-10-22)
Anaplastic astrocytoma WHO grade III (A3) is a lethal brain tumor that often occurs in middle aged patients. Clinically, it is challenging to distinguish A3 from glioblastoma multiforme (GBM) WHO grade IV. To reveal the genetic landscape of this tumor
Zhijun Duan et al.
Molecular and cellular biology, 24(1), 58-70 (2003-12-16)
Mutations in ELA2, encoding the human serine protease neutrophil elastase, cause cyclic and severe congenital neutropenia, and recent evidence indicates that the mutations alter the membrane trafficking of neutrophil elastase. These disorders feature impaired bone marrow production of neutrophils along
Yi-Ping Fu et al.
Molecular cancer, 9, 113-113 (2010-05-21)
A recent genome-wide association study (GWAS) has identified a single nucleotide polymorphism (SNP) rs11249433 in the 1p11.2 region as a novel genetic risk factor for breast cancer, and this association was stronger in patients with estrogen receptor (ER)+ versus ER-

Questions

Reviews

No rating value

Active Filters

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service