WH0011027M17

Monoclonal Anti-LILRA2 antibody produced in mouse

clone 3C7, purified immunoglobulin, buffered aqueous solution

• Synonym(s): Anti-CD85H, Anti-ILT1, Anti-LIR-7, Anti-LIR7, Anti-leukocyte immunoglobulin-like receptor, subfamily A (with TM domain), member 2
• UNSPSC Code: 12352203
• NACRES: NA.41

Properties

• biological source: mouse
• Quality Level: 100
• conjugate: unconjugated
• antibody form: purified immunoglobulin
• antibody product type: primary antibodies
• clone: 3C7, monoclonal
• form: buffered aqueous solution
• species reactivity: human
• technique(s): indirect ELISA: suitable; western blot: 1-5 μg/mL
• isotype: IgG2bκ
• GenBank accession no.: NM_006866
• UniProt accession no.: Q8N149
• shipped in: dry ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... LILRA2(11027)

Description

General description

Leukocyte Ig-like receptors (LIRs) are a family of immunoreceptors expressed predominantly on monocytes and B cells and at lower levels on dendritic cells and natural killer (NK) cells. All LIRs in subfamily B have an inhibitory function (see, e.g., LILRB1, MIM 604811). LIRs in subfamily A, with short cytoplasmic domains lacking an immunoreceptor tyrosine-based inhibitory motif (ITIM) and with transmembrane regions containing a charged arginine residue, may initiate stimulatory cascades. One member of subfamily A (LILRA3; MIM 604818) lacks a transmembrane region and is presumed to be a soluble receptor.[supplied by OMIM

Immunogen

LILRA2 (NP_006857, 322 a.a. ~ 383 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
DRPSLSVQPVPTVAPGKNVTLLCQSRGQFHTFLLTKEGAGHPPLHLRSEHQAQQNQAEFRMG

Physical form

Solution in phosphate buffered saline, pH 7.4

Legal Information

GenBank is a registered trademark of United States Department of Health and Human Services

Safety Information

• Storage Class Code: 10 - Combustible liquids
• Flash Point(F): Not applicable
• Flash Point(C): Not applicable
• Personal Protective Equipment: dust mask type N95 (US), Eyeshields, Gloves