Skip to Content
Merck
All Photos(5)

Key Documents

WH0008841M2

Sigma-Aldrich

Monoclonal Anti-HDAC3 antibody produced in mouse

clone 3E11, purified immunoglobulin, buffered aqueous solution

Synonym(s):

Anti-HD3, Anti-RPD3, Anti-RPD32, Anti-histone deacetylase 3

Sign Into View Organizational & Contract Pricing

Select a Size

100 μG
€490.00

€490.00


Please contact Customer Service for Availability


Select a Size

Change View
100 μG
€490.00

About This Item

MDL number:
UNSPSC Code:
12352203
NACRES:
NA.41

€490.00


Please contact Customer Service for Availability

biological source

mouse

Quality Level

conjugate

unconjugated

antibody form

purified immunoglobulin

antibody product type

primary antibodies

clone

3E11, monoclonal

form

buffered aqueous solution

species reactivity

rat, mouse, human

technique(s)

indirect ELISA: suitable
western blot: 1-5 μg/mL

isotype

IgG2aκ

GenBank accession no.

UniProt accession no.

shipped in

dry ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... HDAC3(8841)

General description

Histone deacetylase 3 (HDAC3) is an epigenetic modifier and is expressed in various tissues. It belongs to the class I subfamily of histone deacetylases. The HDAC3 gene is localized on human chromosome 5q31.3.

Immunogen

HDAC3 (NP_003874, 319 a.a. ~ 428 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
ISEELPYSEYFEYFAPDFTLHPDVSTRIENQNSRQYLDQIRQTIFENLKMLNHAPSVQIHDVPADLLTYDRTDEADAEERGPEENYSRPEAPNEFYDGDHDNDKESDVEI

Physical form

Solution in phosphate buffered saline, pH 7.4

Legal Information

GenBank is a registered trademark of United States Department of Health and Human Services

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Personal Protective Equipment

dust mask type N95 (US), Eyeshields, Gloves

Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

HDAC3 role in medication consumption in medication overuse headache patients: a pilot study.
Pisanu C, et al.
Human Genomics, 9, 30-30 (2015)
Histone deacetylase 3 indirectly modulates tubulin acetylation.
Bacon T, et al.
The Biochemical Journal, 472(3), 367-377 (2015)
Hdac3 Is Essential for the Maintenance of Chromatin Structure and Genome Stability.
Srividya B, et al.
Cancer Cell, 18(5), 436-447 (2010)
Rebekah Tillotson et al.
Molecular cell, 81(6), 1260-1275 (2021-02-10)
DNA methylation is implicated in neuronal biology via the protein MeCP2, the mutation of which causes Rett syndrome. MeCP2 recruits the NCOR1/2 co-repressor complexes to methylated cytosine in the CG dinucleotide, but also to sites of non-CG methylation, which are

Questions

Reviews

No rating value

Active Filters

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service