Synthetic peptide directed towards the C terminal of human B3GALT2
Biochem/physiol Actions
B3galt2 is beta-1,3-galactosyltransferase that transfers galactose from UDP-galactose to substrates with a terminal beta-N-acetylglucosamine (beta-GlcNAc) residue. B3galt2 can also utilize substrates with a terminal galactose residue, albeit with lower efficiency. B3galt2 is involved in the biosynthesis of the carbohydrate moieties of glycolipids and glycoproteins.
Sequence
Synthetic peptide located within the following region: RVDPVPPPNEFVFNHWRVSYSSCKYSHLITSHQFQPSELIKYWNHLQQNK
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
FASEB journal : official publication of the Federation of American Societies for Experimental Biology, 36(10), e22542-e22542 (2022-09-13)
Ischemic stroke is one of the major causes of morbidity and mortality. The β-1, 3-galactosyltransferase 2 (B3galt2), a member of β-1, 3-galactosyltransferase family, is playing a vital role in the pathological process of cerebral ischemic injury, but its underlying mechanisms
Questions
Reviews
★★★★★ No rating value
Active Filters
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
