SAB1404208

Monoclonal Anti-PITX1, (C-terminal) antibody produced in mouse

clone 6D4, purified immunoglobulin, buffered aqueous solution

• Synonym(s): BFT, POTX, PTX1
• UNSPSC Code: 12352203
• NACRES: NA.41

Properties

• biological source: mouse
• Quality Level: 100
• conjugate: unconjugated
• antibody form: purified immunoglobulin
• antibody product type: primary antibodies
• clone: 6D4, monoclonal
• form: buffered aqueous solution
• mol wt: antigen ~35.9 kDa
• species reactivity: human
• technique(s): capture ELISA: suitable; indirect ELISA: suitable; western blot: 1-5 μg/mL
• isotype: IgG2aκ
• NCBI accession no.: NM_002653
• UniProt accession no.: P78337
• shipped in: dry ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... PITX1(5307)

Description

General description

This gene encodes a member of the RIEG/PITX homeobox family, which is in the bicoid class of homeodomain proteins. Members of this family are involved in organ development and left-right asymmetry. This protein acts as a transcriptional regulator involved in basal and hormone-regulated activity of prolactin. (provided by RefSeq)

Immunogen

PITX1 (NP_002644, 225 a.a. ~ 313 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MPSSMGPGAVPGMPNSGLNNINNLTGSSLNSAMSPGACPYGTPASPYSVYRDTCNSSLASLRLKSKQHSSFGYGGLQGPASGLNACQYN

Physical form

Solution in phosphate buffered saline, pH 7.4

Safety Information

• Storage Class Code: 10 - Combustible liquids
• WGK: WGK 1
• Flash Point(F): Not applicable
• Flash Point(C): Not applicable