Skip to Content
Merck
All Photos(4)

Key Documents

SAB1404011

Sigma-Aldrich

Anti-KRAS Antibody

mouse monoclonal, 4F3

Synonym(s):

C-K-RAS, K-RAS2A, K-RAS2B, K-RAS4A, K-RAS4B, KI-RAS, KRAS1, KRAS2, NS3

Sign Into View Organizational & Contract Pricing

Select a Size

100 μG
€490.00

€490.00


Please contact Customer Service for Availability


Select a Size

Change View
100 μG
€490.00

About This Item

UNSPSC Code:
12352203
NACRES:
NA.41

€490.00


Please contact Customer Service for Availability

Product Name

Monoclonal Anti-KRAS antibody produced in mouse, clone 4F3, purified immunoglobulin, buffered aqueous solution

biological source

mouse

Quality Level

conjugate

unconjugated

antibody form

purified immunoglobulin

antibody product type

primary antibodies

clone

4F3, monoclonal

form

buffered aqueous solution

mol wt

antigen ~38.21 kDa

species reactivity

human

technique(s)

capture ELISA: suitable
indirect ELISA: suitable
western blot: 1-5 μg/mL

isotype

IgG2aκ

NCBI accession no.

UniProt accession no.

shipped in

dry ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... KRAS(3845)

General description

This gene, a Kirsten ras oncogene homolog from the mammalian ras gene family, encodes a protein that is a member of the small GTPase superfamily. A single amino acid substitution is responsible for an activating mutation. The transforming protein that results is implicated in various malignancies, including lung adenocarcinoma, mucinous adenoma, ductal carcinoma of the pancreas and colorectal carcinoma. Alternative splicing leads to variants encoding two isoforms that differ in the C-terminal region. (provided by RefSeq)
c-K-Ras or KRAS (Kirsten rat sarcoma-2 virus oncogene) is a small GTP-binding protein. The gene encoding it is localized on human chromosome 12p12.1. KRAS has two splice variants, that is, KRASA and KRASB (KRAS proto-oncogenes). Expression of KRASA is restricted to specific tissues whereas KRASB is ubiquitously expressed.

Immunogen

KRAS (NP_004976, 16 a.a. ~ 125 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
KSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDLPSRTV

Application

Monoclonal Anti-KRAS antibody produced in mouse has been used in Western Blotting.[1]

Biochem/physiol Actions

KRAS (Kirsten rat sarcoma-2 virus oncogene) mutation has been associated with early rectal cancer and colorectal cancer. The protein has a role in signaling pathways.
KRAS (kirsten rat sarcoma-2 virus oncogene) upon binding to a cell surface receptor, including EGFR functions as a self-inactivating signal transducer by cycling from GDP- to GTP-bound states. Mutation in the gene leads to poor prognosis of early rectal cancer.

Physical form

Solution in phosphate buffered saline, pH 7.4

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 1

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable


Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Prognostic value of KRAS codon 13 gene mutation for overall survival in colorectal cancer
Kwak MS, et al.
Medicine, 96(35) (2017)
KRAS G12C Drug Development: Discrimination between Switch II Pocket Configurations Using Hydrogen/Deuterium-Exchange Mass Spectrometry
Lu J, et al.
Structure, 25(9), 1442-1448 (2017)
David M Briere et al.
Molecular cancer therapeutics, 20(6), 975-985 (2021-03-17)
KRASG12C inhibitors, including MRTX849, are promising treatment options for KRAS-mutant non-small cell lung cancer (NSCLC). PD-1 inhibitors are approved in NSCLC; however, strategies to enhance checkpoint inhibitor therapy (CIT) are needed. KRASG12C mutations are smoking-associated transversion mutations associated with high
The prognostic value of KRAS mutation by cell-free DNA in cancer patients: a systematic review and meta-analysis.
Zhuang R, et al.
PLoS ONE, 12(8), e0182562-e0182562 (2017)
Jia Lu et al.
Structure (London, England : 1993), 25(9), 1442-1448 (2017-08-07)
KRAS G12C, the most common RAS mutation found in non-small-cell lung cancer, has been the subject of multiple recent covalent small-molecule inhibitor campaigns including efforts directed at the guanine nucleotide pocket and separate work focused on an inducible pocket adjacent

Questions

  1. Could you verify if Product No. SAB1404011, Monoclonal Anti-KRAS antibody, has cross-reactivity with N-Ras and H-Ras?

    1 answer
    1. We have not conducted experiments to determine whether Product No. SAB1404011, Monoclonal Anti-KRAS antibody, clone 4F3, will react with Human NRAS (UniProt P01111) and Human HRAS (UniProt P01112). However, based on the alignment data, there is a high probability of recognition, though we cannot guarantee it. In the comparison, the similarity between Human HRAS (UniProt P01112) and SAB1404011 KRAS monoclonal antibody, clone 4F3 is very high (96%), suggesting theoretical recognition. Similarly, the similarity between Human NRAS (UniProt P01111) and SAB1404011 KRAS monoclonal antibody, clone 4F3 is also very high (95%), indicating theoretical recognition.

      Helpful?

Reviews

No rating value

Active Filters

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service