Skip to Content
Merck
All Photos(4)

Key Documents

SAB1401891

Sigma-Aldrich

Monoclonal Anti-HOOK3 antibody produced in mouse

clone 3A5, purified immunoglobulin, buffered aqueous solution

Synonym(s):

FLJ31058, HK3

Sign Into View Organizational & Contract Pricing

Select a Size

100 μG
€417.00

€417.00


Please contact Customer Service for Availability


Select a Size

Change View
100 μG
€417.00

About This Item

UNSPSC Code:
12352203
NACRES:
NA.41

€417.00


Please contact Customer Service for Availability

biological source

mouse

conjugate

unconjugated

antibody form

purified immunoglobulin

antibody product type

primary antibodies

clone

3A5, monoclonal

form

buffered aqueous solution

species reactivity

human

technique(s)

capture ELISA: suitable
western blot: 1-5 μg/mL

isotype

IgG2aκ

NCBI accession no.

UniProt accession no.

shipped in

dry ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... HOOK3(84376)

General description

Hook proteins are cytosolic coiled-coil proteins that contain conserved N-terminal domains, which attach to microtubules, and more divergent C-terminal domains, which mediate binding to organelles. The Drosophila Hook protein is a component of the endocytic compartment.[supplied by OMIM

Immunogen

HOOK3 (NP_115786.1, 622 a.a. ~ 718 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
QNQGAAPEIQALKNQLQERDRLFHSLEKEYEKTKSQREMEEKYIVSAWYNMGMTLHKKAAEDRLASTGSGQSFLARQRQATSSRRSYPGHVQPATAR

Biochem/physiol Actions

In Caenorhabditis elegans, the HOOK3 (hook microtubule-tethering protein 3) protein is required for connecting the centrosome and the nucleus. It participates in transport of pericentriolar satellites, needed for centrosomal assembly in neurogenesis. HOOK3-RET (ret proto-oncogene) fusion protein is identified in papillary thyroid carcinoma and it results in tumor formation in nude mice. In presence of Salmonella enterica infection, the Salmonella SpiC (pathogenicity island 2 secreted effector protein) inactivates HOOK3 function and thereby affects the cellular trafficking and phagosome-lysosome fusion.

Physical form

Solution in phosphate buffered saline, pH 7.4

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable


Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Xuecai Ge et al.
Neuron, 65(2), 191-203 (2010-02-16)
Centrosome functions are important in multiple brain developmental processes. Proper functioning of the centrosome relies on assembly of protein components into the pericentriolar material. This dynamic assembly is mediated by the trafficking of pericentriolar satellites, which are comprised of centrosomal
Raffaele Ciampi et al.
Endocrine-related cancer, 14(2), 445-452 (2007-07-20)
Chromosomal rearrangements of the RET proto-oncogene (RET/PTC) are the common feature of papillary thyroid carcinoma (PTC). In this study, we report the identification, cloning, and functional characterization of a novel type of RET/PTC rearrangement that results from the fusion of
Yoram Shotland et al.
Molecular microbiology, 49(6), 1565-1576 (2003-09-03)
The Salmonella SpiC protein is secreted into the cytosol of macrophages via a unique type III secretion system that functions intracellularly to translocate proteins across the phagosomal membrane. The SpiC protein is required for survival within macrophages and inhibition of

Questions

Reviews

No rating value

Active Filters

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service