Skip to Content
Merck
All Photos(1)

Documents

QPREST27836

Sigma-Aldrich

SILuPrEST ZCPW2

SILuPrESTs Powered by Atlas Antibodies, buffered aqueous solution

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352200

recombinant

expressed in E. coli LysA ArgA BL21(DE3)

Assay

>80% (SDS-PAGE)

form

buffered aqueous solution

mol wt

predicted mol wt 26kDa including tags

purified by

immobilized metal affinity chromatography (IMAC)

packaging

pkg of 1nmol × 5 vials

storage condition

avoid repeated freeze/thaw cycles

immunogen sequence

TATPDESEEGHGEEINMGEKLSKCSPEAPAGSLFENHYEEDYLVIDGIKLKAGECIEDITNKFKEIDALMSEF

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

Gene Information

human ... ZCPW2(152098)

General description

Lys, Arg 13C and 15N metabolically labeled recombinant human protein fragment

Application

Internal standard in MS-based quantitative proteomics

Physical form

Heavy proteins are provided in solution of 1M Urea PBS, pH 7.4

Preparation Note

The protein solution should be gently mixed before use. Optimal concentrations and conditions for each application should be determined by the user.

Analysis Note

Isotopic Label Incorporation

The SILuPrEST standards are produced using metabolic labeling with heavy isotope labeled (15N, 13C) Lysine and Arginine residues, with greater than 99% isotopic label incorporation.
A purification and quantification tag (QTag) consisting of a hexahistidine (His6) sequence followed by an Albumin Binding Protein (ABP) domain derived from Streptococcal Protein G.
All SILuPrESTs contain an N-terminal His6ABP fusion tag, used for accurate determination of concentration. The fusion tag sequence is:

GSSHHHHHHSSGLVPRGSHMASLAEAKVLANRELDKYGVSDYHKNLINNAKTVEGVKDLQAQVVESAKKARISEATDGLSDFLKSQTPAEDTVKSIELAEAKVLANRELDKYGVSDYYKNLINNAKTVEGVKALIDEILAALPGTFAHYMDPNSSSVDKLAAA.

The specific human protein sequence begins directly after ′VDKLAAA′.

Legal Information

This product is licensed under U.S. Patent No. 7,396,688 and foreign counterparts from E. I. du Pont de Nemours and Company. The purchase of this product conveys to the buyer the nontransferable right to use the purchased amount of the product for research and development only, including services for a third party for consideration. The buyer cannot sell or otherwise transfer this product, its components or materials made using this product or its components to a third party. Information about licenses for excluded uses is available from: E. I. du Pont de Nemours and Company; Attn: Associate Director, Commercial Development; DuPont Experimental Station E268; 200 Powdermill Rd.; Wilmington, DE 19803; 1-877-881-9787 (voice), 1-302-695-1437 (fax), licensing@dupont.com
SILu is a trademark of Sigma-Aldrich Co. LLC

Storage Class Code

12 - Non Combustible Liquids

WGK

WGK 1

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable


Certificates of Analysis (COA)

Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service