HPA002380
Anti-ABCC1 antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution, Ab1
Synonym(s):
Anti-ATP-binding cassette sub-family C member 1, Anti-LTC4 transporter, Anti-Leukotriene C(4, Anti-Multidrug resistance-associated protein 1
Sign Into View Organizational & Contract Pricing
All Photos(2)
About This Item
Recommended Products
biological source
rabbit
conjugate
unconjugated
antibody form
affinity isolated antibody
antibody product type
primary antibodies
clone
polyclonal
product line
Prestige Antibodies® Powered by Atlas Antibodies
form
buffered aqueous glycerol solution
species reactivity
human
technique(s)
immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:50-1:200
immunogen sequence
LVTHSMSYLPQVDVIIVMSGGKISEMGSYQELLARDGAFAEFLRTYASTEQEQDAEENGVTGVSGPGKEAKQMENGMLVTDSAGKQLQRQLSSSSSYSGDISRHHNSTAELQKAEAKKEETWKLMEADKAQTGQVKLSVYWD
UniProt accession no.
shipped in
wet ice
storage temp.
−20°C
target post-translational modification
unmodified
Gene Information
human ... ABCC1(4363)
General description
ABCC1 (ATP binding cassette subfamily C member 1) is the members of the ATP-binding cassette (ABC) transporter superfamily. It is expressed in both endothelial cells and non-endothelia cells. Non-endothelial cells include pericytes, astrocytes, choroid plexus epithelia, ventricle ependymal cells, and neurons and larger blood vessels (mostly venules), microvasculature endothelial cells. Similar to other ABC transporters, ABCC1 also possess an additional membrane-spanning domain (MSD) with a putative extracellular, U-shaped amino terminus region.
Immunogen
Multidrug resistance-associated protein 1 recombinant protein epitope signature tag (PrEST)
Application
Anti-ABCC1 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.
Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.
Immunohistochemistry (1 paper)
Western Blotting (1 paper)
Immunohistochemistry (1 paper)
Western Blotting (1 paper)
Biochem/physiol Actions
The amino terminus end of ABCC1 (ATP binding cassette subfamily C member 1) serve as a regulating gate for the drug transport activity. Its activity is dependent on the ATP binding and hydrolysis. It plays a pivotal role in drug binding as well as drug and organic anion efflux across the plasma membrane. It mediates ATP-dependent transport of glutathione and glutathione conjugates, leukotriene C4, estradiol-17-β-glucuronide, methotrexate, antiviral drugs and other xenobiotics. It may play an important role in adenosinergic/purinergic neuromodulation. It has a significant role in the regulation of dendritic cells (DCs) migration from peripheral tissues to lymph nodes by utilizing the leukotriene C(4) (LTC(4)) transporter. ABCC1 is associated with different neurodegenerative diseases (NDs), such as Alzheimer′s and Parkinson′s.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:
Every Prestige Antibody is tested in the following ways:
- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
Linkage
Corresponding Antigen APREST86067
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide
Legal Information
Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Not finding the right product?
Try our Product Selector Tool.
Storage Class Code
10 - Combustible liquids
WGK
WGK 1
Flash Point(F)
Not applicable
Flash Point(C)
Not applicable
Certificates of Analysis (COA)
Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
Mark Barok et al.
Cancer letters, 473, 156-163 (2020-01-07)
The majority of HER2-positive breast or gastric cancers treated with T-DM1 eventually show resistance to this agent. We compared the effects of T-DM1 and ARX788, a novel anti-HER2 antibody-drug conjugate, on cell growth and apoptosis in HER2-positive breast cancer and
Hans-Gert Bernstein et al.
Mechanisms of ageing and development, 141-142, 12-21 (2014-09-15)
ATP-binding cassette (ABC) transporters play an increasing role in the understanding of pathologic peptide deposition in neurodegenerative diseases (NDs), such as Alzheimer's and Parkinson's. To describe the location of the most important ABC transporters for NDs in human brain tissue
Virgílio Souza E Silva et al.
Diagnostics (Basel, Switzerland), 11(3) (2021-04-04)
The discovery of predictive biomarkers in metastatic colorectal cancer (mCRC) is essential to improve clinical outcomes. Recent data suggest a potential role of circulating tumor cells (CTCs) as prognostic indicators. We conducted a follow-on analysis from a prospective study of
Gwenaëlle Conseil et al.
The Journal of biological chemistry, 281(1), 43-50 (2005-10-19)
The multidrug resistance protein 1 (MRP1) mediates drug and organic anion efflux across the plasma membrane. The 17 transmembrane (TM) helices of MRP1 are linked by extracellular and cytoplasmic (CL) loops of various lengths and two cytoplasmic nucleotide binding domains.
Qun Chen et al.
The Journal of biological chemistry, 281(41), 31152-31163 (2006-08-18)
Multidrug resistance is a serious problem in successful cancer chemotherapy. Studies using model cell lines have demonstrated that overexpression of some members of the ATP-binding cassette (ABC) transporter superfamily, such as ABCC1, causes enhanced efflux and, thus, decreased accumulation of
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
Contact Technical Service