Skip to Content
Merck
All Photos(1)

Key Documents

AV38090

Sigma-Aldrich

Anti-EGR4 antibody produced in rabbit

affinity isolated antibody

Synonym(s):

Anti-Early growth response 4

Sign Into View Organizational & Contract Pricing

Select a Size

100 μL
€498.00

€498.00


Please contact Customer Service for Availability


Select a Size

Change View
100 μL
€498.00

About This Item

UNSPSC Code:
12352203
NACRES:
NA.41

€498.00


Please contact Customer Service for Availability

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

51 kDa

species reactivity

rat, horse, mouse, dog, rabbit, bovine, human, guinea pig

concentration

0.5 mg - 1 mg/mL

technique(s)

western blot: suitable

NCBI accession no.

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... EGR4(1961)

General description

Early growth response (Egr) proteins are transcriptional regulators (Egr1-4) of gene expression involved in the growth and differentiation of many cells. Early growth response 4 (EGR4, NGFI-C, pAT133), a member of the Egr family of zinc-finger transcription factors, regulates early stage meiosis and functions as a master gene transcription regulator of processes such as spermatogenesis and male fertility. Egr4 is an important component in the mechanism for trophic factor-mediated upregulation of K-Cl cotransporter (KCC2) in immature neurons.

Specificity

Anti-EGR4 polyclonal antibody reacts with human, mouse, rat, canine, zebrafish, bovine, and chicken early growth response 4 proteins.

Immunogen

Synthetic peptide directed towards the C terminal region of human EGR4

Application

Anti-EGR4 polyclonal antibody is used to tag early growth response 4 proteins for detection and quantitation by Western blotting and in cells and tissues by immunohistochemical (IHC) techniques. It is used as a probe to study the role of early growth response 4 protein in spermatogenesis and male fertility.

Biochem/physiol Actions

The nerve growth factor-induced clone C (NGFI-C/EGR4) gene is a zinc-finger transcription factor that is rapidly induced by nerve growth factor in rat pheochromocytoma PC12 cells and by seizure in brain. NGFI-C/EGR4 is closely related to the previously described early response genes, nerve growth factor-induced clone A (NGFI-A or EGR1), EGR2, and EGR3. These four early response (immediate early) proteins all contain very similar zinc-finger DNA binding domains and five highly homologous subdomains. EGR-4 functionally cooperate with NFAT proteins and induce expression of IL-2 and TNFalpha. Early growth response proteins (EGR) and nuclear factors of activated T cells (NFAT) form heterodimers and regulate proinflammatory cytokine gene expression.

Sequence

Synthetic peptide located within the following region: RSDHLTSHVRTHTGEKPFACDVCGRRFARSDEKKRHSKVHLKQKARAEER

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 3

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable


Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Questions

Reviews

No rating value

Active Filters

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service