Skip to Content
Merck
All Photos(1)

Key Documents

AV09034

Sigma-Aldrich

Anti-RNASEL antibody produced in rabbit

IgG fraction of antiserum

Synonym(s):

Anti-Ribonuclease L (2′,5′-oligoisoadenylate synthetase-dependent)

Sign Into View Organizational & Contract Pricing

Select a Size

100 μL
€326.00

€326.00


Please contact Customer Service for Availability


Select a Size

Change View
100 μL
€326.00

About This Item

UNSPSC Code:
12352203
NACRES:
NA.41

€326.00


Please contact Customer Service for Availability

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

IgG fraction of antiserum

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

84 kDa

species reactivity

horse, human

concentration

0.5 mg - 1 mg/mL

technique(s)

western blot: suitable

NCBI accession no.

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... RNASEL(6041)

Immunogen

Synthetic peptide directed towards the C terminal region of human RNASEL

Application

Anti-RNASEL antibody produced in rabbit is suitable for western blotting at a concentration of 1 μg/ml.

Biochem/physiol Actions

Endoribonuclease L (RNaseL) is an enzyme activated by its allosteric activator 2′,5′-linked oligoadenylates (2-5A). The 2-5A/RNaseL system is induced by interferons and cleaves single-stranded RNA molecules in U-rich sequences. This pathway mediates immunomodulatory, antiviral and antiproliferative effects.

Sequence

Synthetic peptide located within the following region: MKLKIGDPSLYFQKTFPDLVIYVYTKLQNTEYRKHFPQTHSPNKPQCDGA

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 3

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable


Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Arindam Chakrabarti et al.
Journal of interferon & cytokine research : the official journal of the International Society for Interferon and Cytokine Research, 31(1), 49-57 (2010-12-31)
The interferon (IFN)-inducible 2'-5'-oligoadenylate synthetase (OAS)/RNase L pathway blocks infections by some types of viruses through cleavage of viral and cellular single-stranded RNA. Viruses induce type I IFNs that initiate signaling to the OAS genes. OAS proteins are pathogen recognition
Heather J Ezelle et al.
Frontiers in bioscience (Scholar edition), 4, 767-786 (2011-12-29)
The endoribonuclease RNase-L is the terminal component of an RNA cleavage pathway that mediates antiviral, antiproliferative and immunomodulatory activities. Inactivation or dysregulation of RNase-L is associated with a compromised immune response and increased risk of cancer, accordingly its activity is
Catherine Bisbal et al.
Biochimie, 89(6-7), 789-798 (2007-04-03)
The endoribonuclease L (RNase L) is the effector of the 2-5A system, a major enzymatic pathway involved in the molecular mechanism of interferons (IFNs). RNase L is a very unusual nuclease with a complex mechanism of regulation. It is a

Questions

Reviews

No rating value

Active Filters

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service