APREST82394
PrEST Antigen NAPA
Prestige Antigens™ Powered by Atlas Antibodies, buffered aqueous solution
Sign Into View Organizational & Contract Pricing
All Photos(1)
About This Item
recombinant
expressed in E. coli
Assay
>80% (SDS-PAGE)
form
buffered aqueous solution
mol wt
predicted mol wt 22 kDa
purified by
immobilized metal affinity chromatography (IMAC)
concentration
≥0.5 mg/mL
immunogen sequence
IEEACEIYARAANMFKMAKNWSAAGNAFCQAAQLHLQLQSKHD
Ensembl | human accession no.
UniProt accession no.
shipped in
wet ice
storage temp.
−20°C
Gene Information
human ... NAPA(8775)
General description
Recombinant protein fragment of Human NAPA with N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G) fusion tag.
Application
Suitable as a blocking agent using corresponding antibodies.
Linkage
Corresponding Antibody HPA046149.
Physical form
Solution in 1 M urea-PBS, pH 7.4
Preparation Note
The protein solution should be gently mixed before use. Optimal concentrations and conditions for each application should be determined by the user.
Legal Information
Prestige Antigens is a trademark of Sigma-Aldrich Co. LLC
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Storage Class Code
10 - Combustible liquids
WGK
WGK 2
Flash Point(F)
Not applicable
Flash Point(C)
Not applicable
Certificates of Analysis (COA)
Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
Contact Technical Service