Skip to Content
Merck
All Photos(3)

Key Documents

HPA011332

Sigma-Aldrich

Anti-IGF2R antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym(s):

Anti-300 kDa mannose 6-phosphate, Anti-CI Man-6-P receptor, Anti-CI-MPR, Anti-Cation-independent mannose-6-phosphate receptor precursor, Anti-IGF-II receptor, Anti-Insulin-like growth factor 2 receptor, Anti-Insulin-like growth factor II receptor, Anti-M6P/IGF2 receptor, Anti-M6P/IGF2R, Anti-M6PR

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203
Human Protein Atlas Number:
NACRES:
NA.41

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human

technique(s)

immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:200-1:500

immunogen sequence

CKKDIFKANKEVPCYVFDEELRKHDLNPLIKLSGAYLVDDSDPDTSLFINVCRDIDTLRDPGSQLRACPPGTAACLVRGHQAFDVGQPRDGLKLVRKDRLVLSYVREEAGKLDFCDGHSPAVTITFVCPSE

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... IGF2R(3482)

General description

IGF2R (insulin-like growth factor 2 receptor) is a transmembrane glycoprotein. It is one of the two mannose 6-phosphate (M6P) receptors found in mammalian cells. It has 15 consecutive repeating regions making up a repetitive structure. The domains 3 and 9 contain M6P-binding sites. Domain 5 contains M6P-N-acetylglucosamine residue- binding site. The IGF-II binding site is located in domain 11. It belongs to p-lectin family and has a molecular weight of 300kDa. It has an N-terminal, a small cytosolic C-terminal, a transmembrane region and a large exosolic domain.

Immunogen

Cation-independent mannose-6-phosphate receptor precursor recombinant protein epitope signature tag (PrEST)

Application

Anti-IGF2R antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.
Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.
Western Blotting (1 paper)

Biochem/physiol Actions

IGF2R (insulin-like growth factor 2 receptor) regulates multiple cellular processes such as, cell survival, proliferation, migration and invasion, endocytosis, lysosomal trafficking. Its ligands are divided in two major classes- mannose 6-phosphate (M6P)-containing and non-M6P. The former class includes lysosomal acid hydrolases, TGF (transforming growth factor)-β, proliferin, thyroglobulin, and granzyme B, while the latter class includes mitogen, plasminogen, insulin-like growth factor II (IGF-II) and retinoic acid. Binding of plasminogen to IGF2R leads to the conversion and activation of plasminogen to plasmin. This gene is also mutated in multiple cancers where it might lead to tumorigenesis. It is down-regulated in breast cancer where it supposedly facilitates tumorigenesis. It decreases the metastatic capacity of receptor-deficient SCC-VII squamous cell carcinoma cells, which in turn is modulated by M6P-binding site within domain 3.

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST86865

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 1

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Personal Protective Equipment

dust mask type N95 (US), Eyeshields, Gloves

Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Nicole J Caixeiro et al.
International journal of cancer, 133(11), 2542-2550 (2013-05-21)
Although loss of the mannose 6-phosphate/insulin-like growth factor-II receptor (M6P/IGF-IIR) in breast cancer is believed to play a role in tumorigenesis, it has not been demonstrated that M6P/IGF-IIR loss is sufficient to confer a malignant phenotype in an untransformed cell.
Thaneas Prabakaran et al.
PloS one, 7(6), e39975-e39975 (2012-07-07)
Prominent vasculopathy in Fabry disease patients is caused by excessive intracellular accumulation of globotriaosylceramide (GL-3) throughout the vascular endothelial cells causing progressive cerebrovascular, cardiac and renal impairments. The vascular lesions lead to myocardial ischemia, atherogenesis, stroke, aneurysm, thrombosis, and nephropathy.
Olivia C Probst et al.
The Biochemical journal, 451(1), 91-99 (2013-01-26)
The M6P (mannose 6-phosphate)/IGF2R (insulin-like growth factor II receptor) interacts with a variety of factors that impinge on tumour invasion and metastasis. It has been shown that expression of wild-type M6P/IGF2R reduces the tumorigenic and invasive properties of receptor-deficient SCC-VII
Matthew L Hemming et al.
PloS one, 4(12), e8477-e8477 (2009-12-31)
Beta-site APP cleaving enzyme 1 (BACE1) is a transmembrane aspartyl protease with a lumenal active site that sheds the ectodomains of membrane proteins through juxtamembrane proteolysis. BACE1 has been studied principally for its role in Alzheimer's disease as the beta-secretase
Jodi L Kreiling et al.
The FEBS journal, 279(15), 2695-2713 (2012-06-12)
Oligomerization of the mannose 6-phosphate/insulin-like growth factor II receptor (M6P/IGF2R) is important for optimal ligand binding and internalization. M6P/IGF2R is a tumor suppressor gene that exhibits loss of heterozygosity and is mutated in several cancers. We tested the potential dominant-negative effects

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service