Skip to Content
Merck
All Photos(3)

Documents

AV54576

Sigma-Aldrich

Anti-GCLC antibody produced in rabbit

affinity isolated antibody

Synonym(s):

Anti-GCS, Anti-GLCL, Anti-GLCLC, Anti-Glutamate-cysteine ligase, catalytic subunit

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203
NACRES:
NA.41

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

73 kDa

species reactivity

human, dog, rat, mouse, bovine, guinea pig, rabbit

concentration

0.5 mg - 1 mg/mL

technique(s)

immunohistochemistry: suitable
western blot: suitable

NCBI accession no.

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... GCLC(2729)

Related Categories

Immunogen

Synthetic peptide directed towards the N terminal region of human GCLC

Application

Anti-GCLC antibody produced in rabbit is suitable for western blotting at a concentration of 1μg/mL.

Biochem/physiol Actions

GCLC gene encodes the heavy catalytic subunit of the enzyme glutamate-cysteine ligase, which is the rate limiting enzyme of glutathione synthesis. Mutation at this locus is associated with hemolytic anemia due to deficiency of γ-glutamylcysteine synthetase. Polymorphism in GCLC subunit is found to be associated with sulfamethoxazole-induced hypersensitivity in HIV/AIDS patients in a study. A GAG-trinucleotide repeat polymorphism in the 5′-untranslated region of the gene is shown to lower the levles of GCL activity and GSH (glutathione), a major intracellular antioxidant. Therefore, it is associated with increased risk for lung and aerodigestive tract cancers.

Sequence

Synthetic peptide located within the following region: VLETLQEKGERTNPNHPTLWRPEYGSYMIEGTPGQPYGGTMSEFNTVEAN

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 3

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable


Certificates of Analysis (COA)

Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Yunsheng Li et al.
Molecular reproduction and development, 89(10), 443-458 (2022-08-25)
MicroRNA21 (MIR21) abundance in porcine oocytes and cumulus cells increases during in vitro maturation. The mechanism by which MIR21 regulates oocyte maturation and the effect on the developmental competence of subsequent embryos remains unclear. The objective of this study was
Sailendra N Nichenametla et al.
Molecular carcinogenesis, 52(10), 791-799 (2012-05-23)
Glutathione (GSH), the major intracellular antioxidant, protects against cancer development by detoxifying carcinogens and free radicals and strengthening the immune system. Recently, a GAG-trinucleotide repeat polymorphism in the 5'-untranslated region of the gene for the rate-limiting enzyme for GSH biosynthesis
Sotiria Makri et al.
In vivo (Athens, Greece), 34(4), 1811-1821 (2020-07-02)
Olive mill wastewater (OMW) is a byproduct of olive oil production. The aim of the study was to estimate the redox profile of lambs' vital organs after consumption of an OMW-supplemented feed. Twenty-four lambs received breast milk until day 15.
Peng Han et al.
Oxidative medicine and cellular longevity, 2017, 7612182-7612182 (2018-02-13)
Acute kidney injury (AKI) induced by ischemia-reperfusion is a critical conundrum in many clinical settings. Here, this study aimed to determine whether and how RTA-408, a novel oleanane triterpenoid, could confer protection against renal ischemia-reperfusion injury (IRI) in male mice.
Kun-Ming Chen et al.
Chemical research in toxicology, 35(11), 2152-2159 (2022-10-20)
In a series of previous studies we reported that black raspberry (BRB) powder inhibits dibenzo[a,l]pyrene (DBP)-induced DNA damage, mutagenesis, and oral squamous cell carcinoma (OSCC) development in mice. In the present study, using human oral leukoplakia (MSK-Leuk1) and squamous cell

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service