WH0114804M1

Monoclonal Anti-RNF157 antibody produced in mouse

clone 6B3, purified immunoglobulin, buffered aqueous solution

• Sinónimos: Anti-ring finger protein 157
• UNSPSC Code: 12352203
• NACRES: NA.41

Propiedades

• biological source: mouse
• Quality Level: 100
• conjugate: unconjugated
• antibody form: purified immunoglobulin
• antibody product type: primary antibodies
• clone: 6B3, monoclonal
• form: buffered aqueous solution
• species reactivity: human
• technique(s): indirect ELISA: suitable; western blot: 1-5 μg/mL
• isotype: IgG1κ
• GenBank accession no.: NM_052916
• UniProt accession no.: Q96PX1
• shipped in: dry ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... RNF157(114804)

Descripción

General description

RNF157 (Ring finger protein 157) is a novel E3 ubiquitin ligase predominantly expressed in the brain. It has a molecular mass of 110kDa.

Immunogen

RNF157 (NP_443148, 556 a.a. ~ 655 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
PASRAPSEEGEGLPAESPDSNFAGLPAGEQDAEGNDVIEEEDGSPTQEGQRTCAFLGMECDNNNDFDIASVKALDNKLCSEVCLPGAWQADDNAVSRNAQ

Biochem/physiol Actions

RNF157 (Ring finger protein 157) is highly involved in the regulation of neuronal development and morphology of the neurons. It promotes dendritic growth by interacting with adaptor protein Fe65. Its N-terminal end binds to the second PTB domain of Fe65 to ubiquitinate Fe65 via E3 ligase activity. It has also been reported that RNF157 may be involved in the regulation of membrane protein trafficking.

Physical form

Solution in phosphate buffered saline, pH 7.4

Legal Information

GenBank is a registered trademark of United States Department of Health and Human Services

Información de seguridad

• Storage Class: 10 - Combustible liquids
• wgk_germany: nwg
• flash_point_f: Not applicable
• flash_point_c: Not applicable
• ppe: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)