WH0004586M7
Monoclonal Anti-MUC5AC antibody produced in mouse
clone 2H7, purified immunoglobulin, buffered aqueous solution
Sinónimos:
Anti-MUC5, Anti-mucin 5, subtypes A and C, tracheobronchial/gastric
Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización
About This Item
Productos recomendados
origen biológico
mouse
Nivel de calidad
conjugado
unconjugated
forma del anticuerpo
purified immunoglobulin
tipo de anticuerpo
primary antibodies
clon
2H7, monoclonal
Formulario
buffered aqueous solution
reactividad de especies
human
técnicas
indirect ELISA: suitable
western blot: 1-5 μg/mL
isotipo
IgG1κ
Nº de acceso GenBank
Nº de acceso UniProt
Condiciones de envío
dry ice
temp. de almacenamiento
−20°C
modificación del objetivo postraduccional
unmodified
Información sobre el gen
human ... MUC5AC(4586)
Descripción general
Mucin 5AC (MUC5AC) is encoded by the gene mapped to human chromosome 11p15.5 and is predominantly expressed in the gastric and tracheobronchial mucosae. The MUC5AC protein contains two types of deduced peptide domains such as eight amino acid tandemly repeated (TR) domains and cysteine-rich domains.
Inmunógeno
MUC5AC (XP_495860, 351 a.a. ~ 450 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
NQSTCAVYHRSLIIQQQGCSSSEPVRLAYCRGNCGDSSSMYSLEGNTVEHRCQCCQELRTSLRNVTLHCTDGSSRAFSYTEVEECGCMGRRCPAPGDTQH
Sequence
NQSTCAVYHRSLIIQQQGCSSSEPVRLAYCRGNCGDSSSMYSLEGNTVEHRCQCCQELRTSLRNVTLHCTDGSSRAFSYTEVEECGCMGRRCPAPGDTQH
Acciones bioquímicas o fisiológicas
Increased expression of Mucin 5AC (MUC5AC) leads to epithelial cancer progression, including colon cancer. Therefore, MUC5AC is considered to be a potential target in the treatment of colon cancer. MUC5AC containing the carbohydrate blood-group antigen, Lewis B (LeB) functions as a key receptor for Helicobacter pylori. O-glycoprotein encoded by the gene plays a vital role in mucus formation and epithelium protection. Decreased level of MUC5AC expression in ocular surface might lead to the tear instability in patients with SjÖgren syndrome.
Forma física
Solution in phosphate buffered saline, pH 7.4
Información legal
GenBank is a registered trademark of United States Department of Health and Human Services
Cláusula de descargo de responsabilidad
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
¿No encuentra el producto adecuado?
Pruebe nuestro Herramienta de selección de productos.
Código de clase de almacenamiento
10 - Combustible liquids
Punto de inflamabilidad (°F)
Not applicable
Punto de inflamabilidad (°C)
Not applicable
Equipo de protección personal
Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)
Elija entre una de las versiones más recientes:
Certificados de análisis (COA)
Lot/Batch Number
¿No ve la versión correcta?
Si necesita una versión concreta, puede buscar un certificado específico por el número de lote.
¿Ya tiene este producto?
Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.
Erica Kosmerl et al.
Nutrients, 16(7) (2024-04-13)
The goblet cells of the gastrointestinal tract (GIT) produce glycoproteins called mucins that form a protective barrier from digestive contents and external stimuli. Recent evidence suggests that the milk fat globule membrane (MFGM) and its milk phospholipid component (MPL) can
Pablo Argüeso et al.
Investigative ophthalmology & visual science, 43(4), 1004-1011 (2002-03-30)
To determine whether the relative amounts of mucin mRNA in the conjunctival epithelium and mucin protein in the tears are altered in patients with Sjögren syndrome compared with healthy individuals. Tear fluid was collected from the inferior fornix of normal
A E Biemer-Hüttmann et al.
The journal of histochemistry and cytochemistry : official journal of the Histochemistry Society, 47(8), 1039-1048 (1999-07-29)
We studied the distribution of the four human apomucins MUC1, MUC2, MUC4, and MUC5AC in hyperplastic polyps, serrated adenomas, and traditional adenomas of the colorectum using immunohistochemical techniques, with the aim of comparing and contrasting their patterns of expression. A
Xijia Zhu et al.
Cancer biotherapy & radiopharmaceuticals, 31(7), 261-267 (2016-09-10)
Deregulated expressions of mucins have been found in various malignancies and play a pivotal role in carcinogenesis. MUC5AC, as a secreted mucin, is reported to be aberrantly expressed during epithelial cancer progression, including colon cancer. However, the mechanisms of the
Michaël Perrais et al.
The Journal of biological chemistry, 277(35), 32258-32267 (2002-06-22)
The 11p15 mucin genes (MUC2, MUC5AC, MUC5B and MUC6) possess a cell-specific pattern of expression in normal lung that is altered during carcinogenesis. Growth factors of the epidermal growth factor family are known to target key genes that in turn
Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.
Póngase en contacto con el Servicio técnico