SML2836

Lixisenatide

≥95% (HPLC), Exendin-4-derived glucagon-like peptide-1 receptor (GLP-1R) agonist , lyophilized powder

• Sinónimos: (Des-Pro38)-Exendin-4-(Lys)6 amide, AVE0010, HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPSKKKKKK-NH2, His-Gly-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Leu-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Ser-Lys-Lys-Lys-Lys-Lys-Lys-NH2, ZP10, ZP10A
• Fórmula empírica (notación de Hill): C₂₁₅H₃₄₇N₆₁O₆₅S
• Número CAS: 320367-13-3
• Peso molecular: 4858.49
• UNSPSC Code: 51111800
• NACRES: NA.77
• Assay: ≥95% (HPLC)
• Form: lyophilized powder

Propiedades

• Nombre del producto: Lixisenatide, ≥95% (HPLC)
• Quality Segment: 100
• assay: ≥95% (HPLC)
• form: lyophilized powder
• color: white to beige
• storage temp.: −20°C

Descripción

Biochem/physiol Actions

Exendin-4-derived glucagon-like peptide-1 receptor (GLP-1R) agonist with in vivo therapeutic efficacy in animal models of type 2 diabetes.

Lixisenatide (AVE0010, ZP10A) is a C-terminal amidated synthetic glucagon-like peptide-1 receptor (GLP-1R) agonist peptide whose sequence corresponds to Pro38 deleted exendin-4 with a C-terminal extension by six Lys residues. Lixisenatide exhibits 4-times higher human GLP-1R affinity than GLP-1(7-36) amide and dispalys in vivo therapeutic efficacy in murine and rat models of type 2 diabetes, as well as rat models of dox-induced renal fibrosis, global cerebral I/R injury, abdominal aortic aneurysm (AAA) and Aβ25-35 toxicity.

Información de seguridad

• Clase de almacenamiento: 11 - Combustible Solids
• ¿Qué está pasando?: WGK 3
• Punto de inflamación (°F): Not applicable
• Punto de inflamación (°C): Not applicable