Saltar al contenido
Merck
Todas las fotos(5)

Documentos clave

SAB2107959

Sigma-Aldrich

Anti-ETV5 antibody produced in rabbit

affinity isolated antibody

Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización


About This Item

Código UNSPSC:
12352203
NACRES:
NA.41

origen biológico

rabbit

Nivel de calidad

conjugado

unconjugated

forma del anticuerpo

affinity isolated antibody

tipo de anticuerpo

primary antibodies

clon

polyclonal

Formulario

buffered aqueous solution

mol peso

58kDa

reactividad de especies

horse, human, rabbit, dog, mouse, bovine, guinea pig, rat

concentración

0.5 mg - 1 mg/mL

técnicas

immunoblotting: suitable

Nº de acceso NCBI

Nº de acceso UniProt

Condiciones de envío

wet ice

temp. de almacenamiento

−20°C

modificación del objetivo postraduccional

unmodified

Información sobre el gen

human ... ETV5(2119)

Inmunógeno

Synthetic peptide directed towards the N terminal region of human ETV5

Acciones bioquímicas o fisiológicas

ETV5 Contains 1 ETS DNA-binding domain and belongs to the ETS family. The ETV5 gene expression is regulated by the conventional PKC (cPKC) pathway.ETV5 is subject to SUMO modification and this post-translational modification causes inhibition of transcription-enhancing activity Phosphorylated ETV5 and the actin cytoskeleton regulate CD44-mediated hyaluronan binding in myeloid cells. ERMs (ezrin/radixin/moesin) function as adaptor molecules in the interactions of adhesion receptors and intracellular tyrosine kinases. ETV5 can cooperate with c-Jun and has a role in progression of breast cancer.

Secuencia

Synthetic peptide located within the following region: PFMVPGKSRSEECRGRPVIDRKRKFLDTDLAHDSEELFQDLSQLQEAWLA

Forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

¿No encuentra el producto adecuado?  

Pruebe nuestro Herramienta de selección de productos.

Código de clase de almacenamiento

10 - Combustible liquids

Clase de riesgo para el agua (WGK)

WGK 3

Punto de inflamabilidad (°F)

Not applicable

Punto de inflamabilidad (°C)

Not applicable


Elija entre una de las versiones más recientes:

Certificados de análisis (COA)

Lot/Batch Number

¿No ve la versión correcta?

Si necesita una versión concreta, puede buscar un certificado específico por el número de lote.

¿Ya tiene este producto?

Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.

Visite la Librería de documentos

Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.

Póngase en contacto con el Servicio técnico