Saltar al contenido
Merck

HPA008038

Sigma-Aldrich

ANTI-CDK12 antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Sinónimos:

Anti-CDC2-related protein kinase 7, Anti-CRKRS, Anti-Cdc2-related kinase, arginine/serine-rich, Anti-Cell division cycle 2-related protein kinase 7, Anti-CrkRS

Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización


About This Item

Código UNSPSC:
12352203
Atlas de proteínas humanas número:
NACRES:
NA.43

origen biológico

rabbit

conjugado

unconjugated

forma del anticuerpo

affinity isolated antibody

tipo de anticuerpo

primary antibodies

clon

polyclonal

Línea del producto

Prestige Antibodies® Powered by Atlas Antibodies

Formulario

buffered aqueous glycerol solution

reactividad de especies

human

técnicas

immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:50-1:200

secuencia del inmunógeno

GFSAIDTDERNSGPALTESLVQTLVKNRTFSGSLSHLGESSSYQGTGSVQFPGDQDLRFARVPLALHPVVGQPFLKAEGSSNSVVHAETKLQNYGELGPGTTGASSSGAGLHWGGPTQSSAY

Condiciones de envío

wet ice

temp. de almacenamiento

−20°C

modificación del objetivo postraduccional

unmodified

Información sobre el gen

human ... CRKRS(51755)

Descripción general

Cyclin-dependent kinase 12 (CDK12) is a member of the cyclin-dependent kinase (CDK) family of serine/threonine protein kinases. It is located at 17q12 on the human chromosome. CDK12 is composed of 21 arginine/serine-rich (RS) motifs, a proline-rich motif in between the RS motif, a central kinase domain and a C-terminal region. CDK12 gene encodes a C-terminal repeat domain (CTD) kinase that contains an arginine/serine-rich (RS) domain (CrkRS). It is a 1490 amino acid long and colocalizes with SC35 speckles.

Inmunógeno

Cell division cycle 2-related protein kinase 7 recombinant protein epitope signature tag (PrEST)

Aplicación

ANTI-CDK12 antibody produced in rabbit has been used in immunohistochemistry.
All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.

Acciones bioquímicas o fisiológicas

Cyclin-dependent kinase 12 (CDK-12) interacts with cyclin L1 and cyclin L2 and regulates alternative splicing. This kinase phosphorylates the CTD of the large subunit of RNA polymerase II and regulates transcription elongation. It forms a link between transcription and splicing machinery. It negatively regulates MAPK pathway and has a role in the resistance to estrogen signaling inhibitors during endocrine therapy.
Cyclin-dependent kinase 12 (CDK12) is a transcription-associated CDK. It plays a role in DNA-damage response, splicing and differentiation. Overexpression and mutation of the CDK12 gene is associated with several malignancies.

Características y beneficios

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Ligadura / enlace

Corresponding Antigen APREST71450

Forma física

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Información legal

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

¿No encuentra el producto adecuado?  

Pruebe nuestro Herramienta de selección de productos.

Código de clase de almacenamiento

10 - Combustible liquids

Clase de riesgo para el agua (WGK)

WGK 1

Punto de inflamabilidad (°F)

Not applicable

Punto de inflamabilidad (°C)

Not applicable

Equipo de protección personal

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)


Elija entre una de las versiones más recientes:

Certificados de análisis (COA)

Lot/Batch Number

¿No ve la versión correcta?

Si necesita una versión concreta, puede buscar un certificado específico por el número de lote.

¿Ya tiene este producto?

Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.

Visite la Librería de documentos

CrkRS: a novel conserved Cdc2-related protein kinase that colocalises with SC35 speckles
K Tun K, et al.
Journal of Cell Science, 114(14), 2591-2603 (2001)
Low expression of CDK12 in gastric cancer is correlated with advanced stage and poor outcome
Liu M, et al.
Pathology Research and Practice, 12(1), 152962-152962 (2020)
T Jagomast et al.
Histology and histopathology, 18434-18434 (2022-02-12)
Quantifying protein expression in immunohistochemically stained histological slides is an important tool for oncologic research. The use of computer-aided evaluation of IHC-stained slides significantly contributes to objectify measurements. Manual digital image analysis (mDIA) requires a user-dependent annotation of the region
The emerging roles of CDK12 in tumorigenesis
Paculova H and Kohoutek J
Cell Division, 12(1), 7-7 (2017)
CDK12 Is Necessary to Promote Epidermal Differentiation Through Transcription Elongation.
Li, et al.
Stem Cells, 40, 435-445 (2023)

Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.

Póngase en contacto con el Servicio técnico