HPA002852

Anti-RPS6KA6 antibody produced in rabbit

Ab1, Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

• Sinónimos: Anti-90 kDa ribosomal protein S6 kinase 6 antibody produced in rabbit, Anti-RSK-4 antibody produced in rabbit, Anti-Ribosomal S6 kinase 4 antibody produced in rabbit, Anti-Ribosomal protein S6 kinase α-6 antibody produced in rabbit, Anti-S6K-α 6 antibody produced in rabbit, Anti-p90-RSK 6 antibody produced in rabbit, Anti-pp90RSK4 antibody produced in rabbit
• UNSPSC Code: 12352203
• Human Protein Atlas Number: HPA002852
• NACRES: NA.41

Propiedades

• biological source: rabbit
• Quality Level: 100
• conjugate: unconjugated
• antibody form: affinity isolated antibody
• antibody product type: primary antibodies
• clone: polyclonal
• product line: Prestige Antibodies^® Powered by Atlas Antibodies
• form: buffered aqueous glycerol solution
• species reactivity: human
• technique(s): immunofluorescence: 0.25-2 μg/mL; immunohistochemistry: 1:20-1:50
• immunogen sequence: PFKPASGKPDDTFCFDPEFTAKTPKDSPGLPASANAHQLFKGFSFVATSIAEEYKITPITSANVLPIVQINGNAAQFGEVYELKEDIGVGSYSVCKRCIHATTNMEFAVKIIDKSK
• UniProt accession no.: Q9UK32
• shipped in: wet ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... RPS6KA6(27330)

Descripción

Immunogen

Ribosomal protein S6 kinase α-6 recombinant protein epitope signature tag (PrEST)

Application

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies^® protocols and other useful information.

Biochem/physiol Actions

Ribosomal protein S6 kinase, 90kDa, polypeptide 6 is a protein encoded by the RPS6KA6 gene in humans. It is a member of serine/threomine (Ser/Thr) kinase family and p53-related gene. The gene regulates the replicative and stress-induced senescence of different cells. It is a potential tumor suppressor in multiple cancers and may act as a valuable biomarker for the study of breast cancer carcinogenesis and progression. Its expression pattern and molecular mechanisms in RCCs (renal cell carcinoma) indicates that it could be a potential independent prognostic factor and serves as a new potential therapeutic target for RCC patients. Down-regulation of this gene in breast cancer suggests that it is a breast cancer suppressor gene. The gene is a putative tumor suppressor gene and is a target of the ERK signaling pathway.

Features and Benefits

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST74339

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Información de seguridad

• Storage Class: 10 - Combustible liquids
• wgk_germany: WGK 1
• flash_point_f: Not applicable
• flash_point_c: Not applicable
• ppe: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)