Saltar al contenido
Merck

HPA001401

Sigma-Aldrich

Anti-SOD1 antibody produced in rabbit

enhanced validation

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Sinónimos:

SOD1 Antibody - Anti-SOD1 antibody produced in rabbit, Sod1 Antibody, Anti-Superoxide dismutase [Cu-Zn] antibody produced in rabbit

Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización


About This Item

Código UNSPSC:
12352203
Atlas de proteínas humanas número:
NACRES:
NA.41

origen biológico

rabbit

conjugado

unconjugated

forma del anticuerpo

affinity isolated antibody

tipo de anticuerpo

primary antibodies

clon

polyclonal

Línea del producto

Prestige Antibodies® Powered by Atlas Antibodies

Formulario

buffered aqueous glycerol solution

reactividad de especies

human

validación mejorada

RNAi knockdown
orthogonal RNAseq
Learn more about Antibody Enhanced Validation

técnicas

immunoblotting: 0.04-0.4 μg/mL
immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:1000-1:2500

secuencia del inmunógeno

PVQGIINFEQKESNGPVKVWGSIKGLTEGLHGFHVHEFGDNTAGCTSAGPHFNPLSRKHGGPKDEERHVGDLGNVTADKDGVADVSIEDSVISLSGDHCIIGRTLVVHEKADDLGKGGNEESTKTGNAGSRLACG

Nº de acceso UniProt

Condiciones de envío

wet ice

temp. de almacenamiento

−20°C

modificación del objetivo postraduccional

unmodified

Información sobre el gen

human ... SOD1(6647)

Descripción general

Superoxide dismutase 1 (SOD 1), also called Cu-Zn superoxide dismutase, is a cytosolic protein. It is expressed as five isoforms by alternate splicing. SOD1 is mapped to human chromosome 21q22.11. It exists as a homodimer with intrasubunit disulfide bonds.

Inmunógeno

Superoxide dismutase [Cu-Zn] recombinant protein epitope signature tag (PrEST)

Aplicación

Anti-SOD1 antibody produced in rabbit has been used in:
  • immunoprecipitation of ventral horn of spinal cords samples
  • immunocytochemistry of motor neuron and astrocyte cells
  • immunohistochemical studies of liver specimens

Anti-SOD1 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

Acciones bioquímicas o fisiológicas

SOD1 (superoxide dismutase 1) gene encodes an enzyme that destroys harmful free superoxide radicals in the body to molecular oxygen and hydrogen peroxide. It binds copper and zinc ions. This isozyme is a cytoplasmic homodimer. Defects in this gene have been associated with familial amyotrophic lateral sclerosis that affects upper motor neurons in the brain and lower motor neurons in the brain stem and spinal cord, resulting in fatal paralysis.

Características y beneficios

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Ligadura / enlace

Corresponding Antigen APREST83054

Forma física

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Información legal

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

¿No encuentra el producto adecuado?  

Pruebe nuestro Herramienta de selección de productos.

Código de clase de almacenamiento

10 - Combustible liquids

Clase de riesgo para el agua (WGK)

WGK 1

Punto de inflamabilidad (°F)

Not applicable

Punto de inflamabilidad (°C)

Not applicable

Equipo de protección personal

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)


Elija entre una de las versiones más recientes:

Certificados de análisis (COA)

Lot/Batch Number

¿No ve la versión correcta?

Si necesita una versión concreta, puede buscar un certificado específico por el número de lote.

¿Ya tiene este producto?

Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.

Visite la Librería de documentos

Los clientes también vieron

Teemu P Miettinen et al.
Molecular pharmaceutics, 11(12), 4395-4404 (2014-10-15)
The analgesic and antipyretic compound acetaminophen (paracetamol) is one of the most used drugs worldwide. Acetaminophen overdose is also the most common cause for acute liver toxicity. Here we show that acetaminophen and many structurally related compounds bind quinone reductase
Aberrant association of misfolded SOD1 with Na+/K+ ATPase-alpha3 impairs its activity and contributes to motor neuron vulnerability in ALS
Ruegsegger C, et al.
Acta Neuropathologica, 131(3), 427-451 (2016)
Caffeine intake decreases oxidative stress and inflammatory biomarkers in experimental liver diseases induced by thioacetamide: Biochemical and histological study
Amer MG, et al.
International Journal of Immunopathology and Pharmacology, 30(1), 13-24 (2017)
SOD1 transcriptional and posttranscriptional regulation and its potential implications in ALS
Milani P, et al.
Neurology research international, 2011`, 52-56 (2011)
Multiple transcripts of the human Cu, Zn superoxide dismutase gene
Hirano M, et al.
Biochemical and Biophysical Research Communications, 276(1), 52-56 (2000)

Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.

Póngase en contacto con el Servicio técnico