Saltar al contenido
Merck
Todas las fotos(2)

Documentos clave

AV47815

Sigma-Aldrich

Anti-NPNT antibody produced in rabbit

affinity isolated antibody

Sinónimos:

Anti-EGFL6L, Anti-NephroNectin, Anti-POEM

Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización


About This Item

UNSPSC Code:
12352203
NACRES:
NA.41

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

62 kDa

species reactivity

rat, guinea pig, human, rabbit, mouse, horse, dog

concentration

0.5 mg - 1 mg/mL

technique(s)

western blot: suitable

NCBI accession no.

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... NPNT(255743)

General description

NPNT codes for a nephronectin that is an extracellular matrix protein associated with integrin alpha 8 beta1 in embryonic renal cells. Nephronectin expression has been implicated in diabetic nephropathy and glomerulosclerosis.
Rabbit Anti-NPNT antibody recognizes rabbit, human, mouse, rat, chicken, bovine, and canine NPNT.

Immunogen

Synthetic peptide directed towards the middle region of human NPNT

Application

Rabbit Anti-NPNT antibody is suitable for western blot applications at a concentration of 1μg/ml

Biochem/physiol Actions

NPNT is a functional ligand of integrin alpha-8/beta-1 in kidney development. It regulates with integrin alpha-8/beta-1 the expression of GDNF which is essential for kidney development. It may also play a role in the development and function of various tissues, regulating cell adhesion, spreading and survival through the binding of several integrins.

Sequence

Synthetic peptide located within the following region: TTGLTTIAPAASTPPGGITVDNRVQTDPQKPRGDVFIPRQPSNDLFEIFE

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

¿No encuentra el producto adecuado?  

Pruebe nuestro Herramienta de selección de productos.

Storage Class

10 - Combustible liquids

wgk_germany

WGK 3

flash_point_f

Not applicable

flash_point_c

Not applicable


Elija entre una de las versiones más recientes:

Certificados de análisis (COA)

Lot/Batch Number

¿No ve la versión correcta?

Si necesita una versión concreta, puede buscar un certificado específico por el número de lote.

¿Ya tiene este producto?

Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.

Visite la Librería de documentos

Shinya Nakatani et al.
Nephron. Clinical practice, 122(3-4), 114-121 (2013-05-22)
In a previous proteomic study, we detected increased expression of nephronectin in the glomeruli from patients with diabetic nephropathy (DN). The aim of the present study was to clarify the usefulness of determining glomerular expression of nephronectin in kidney disease.
Shinya Nakatani et al.
Nephrology, dialysis, transplantation : official publication of the European Dialysis and Transplant Association - European Renal Association, 27(5), 1889-1897 (2011-12-17)
To date, little proteomic information has been available from the glomeruli of diabetic patients, possibly due to the clinical limitations of renal biopsy in diabetic patients and insufficient quantities of such specimens for proteome analysis. The purpose of the present
R Brandenberger et al.
The Journal of cell biology, 154(2), 447-458 (2001-07-27)
The epithelial-mesenchymal interactions required for kidney organogenesis are disrupted in mice lacking the integrin alpha8beta1. None of this integrin's known ligands, however, appears to account for this phenotype. To identify a more relevant ligand, a soluble integrin alpha8beta1 heterodimer fused

Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.

Póngase en contacto con el Servicio técnico