Accéder au contenu
Merck
Toutes les photos(2)

Key Documents

WH0006334M4

Sigma-Aldrich

Monoclonal Anti-SCN8A antibody produced in mouse

clone 4G7, purified immunoglobulin, buffered aqueous solution

Synonyme(s) :

Anti-MED, Anti-Nav1.6, Anti-sodium channel, voltage gated, type VIII, alpha

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme
Toutes les photos(2)

About This Item

Numéro MDL:
MFCD03097245
Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41

Source biologique

mouse

Conjugué

unconjugated

Forme d'anticorps

purified immunoglobulin

Type de produit anticorps

primary antibodies

Clone

4G7, monoclonal

Forme

buffered aqueous solution

Espèces réactives

rat, mouse, human

Technique(s)

indirect ELISA: suitable
indirect immunofluorescence: suitable
western blot: 1-5 μg/mL

Isotype

IgG2aκ

Numéro d'accès GenBank

NM_014191

Numéro d'accès UniProt

Q9UQD0

Conditions d'expédition

dry ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... SCN8A(6334)

Description générale

Sodium voltage-gated channel αsubunit 8 (SCN8A) is expressed in the central nervous system. The protein is specifically expressed in the axonal initial segment (AIS) and the nodes of Ranvier of myelinated axons. The gene encoding SCN8A is localized on human chromosome 12q13.13.

Immunogène

SCN8A (NP_055006, 1854 a.a. ~ 1951 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
RVLGDSGELDILRQQMEERFVASNPSKVSYEPITTTLRRKQEEVSAVVLQRAYRGHLARRGFICKKTTSNKLENGGTHREKKESTPSTASLPSYDSVT

Actions biochimiques/physiologiques

Sodium voltage-gated channel αsubunit 8 (SCN8A) has a role in the generation and conduction of action potential. Mutations in the SCN8A gene have been associated with early infantile epileptic encephalopathy type 13.

Forme physique

Solution in phosphate buffered saline, pH 7.4

Informations légales

GenBank is a registered trademark of United States Department of Health and Human Services

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable

Équipement de protection individuelle

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)

Certificats d'analyse (COA)

Recherchez un Certificats d'analyse (COA) en saisissant le numéro de lot du produit. Les numéros de lot figurent sur l'étiquette du produit après les mots "Lot" ou "Batch".

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

SCN8A mutations in Chinese patients with early onset epileptic encephalopathy and benign infantile seizures.
Wang J
BMC Medical Genetics, 18(1), 104-104 (2017)
Sodium channel SCN8A (Nav1.6): properties and de novo mutations in epileptic encephalopathy and intellectual disability.
O'Brien JE and Meisler MH
Frontiers in Genetics (2013)
Muhammad M Hossain et al.
Experimental neurology, 308, 111-119 (2018-07-19)
Parkinson's disease (PD), the second most common age-related progressive neurodegenerative disorder, is characterized by dopamine depletion and the loss of dopaminergic (DA) neurons with accompanying neuroinflammation. Zonisamide is an-anti-convulsant drug that has recently been shown to improve clinical symptoms of
Xiujie Li et al.
British journal of pharmacology, 178(17), 3553-3569 (2021-04-23)
Microglia-related inflammation is associated with the pathology of Parkinson's disease. Functional voltage-gated sodium channels (VGSCs) are involved in regulating microglial function. Here, we aim to investigate the effects of scorpion venom heat-resistant synthesized peptide (SVHRSP) on 6-hydroxydopamine (6-OHDA)-induced Parkinson's disease-like
AQP4 Aggravates Cognitive Impairment in Sepsis-Associated Encephalopathy through Inhibiting Nav 1.6-Mediated Astrocyte Autophagy.
Zhu, et al.
Advanced science (Weinheim, Baden-Wurttemberg, Germany), 10, e2205862-e2205862 (2023)

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique