Accéder au contenu
Merck
Toutes les photos(2)

Key Documents

SAB1403063

Sigma-Aldrich

Monoclonal Anti-KLF2 antibody produced in mouse

clone 1D1, purified immunoglobulin, buffered aqueous solution

Synonyme(s) :

LKLF

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme
Toutes les photos(2)

About This Item

Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41

Source biologique

mouse

Conjugué

unconjugated

Forme d'anticorps

purified immunoglobulin

Type de produit anticorps

primary antibodies

Clone

1D1, monoclonal

Forme

buffered aqueous solution

Poids mol.

antigen ~35.79 kDa

Espèces réactives

human

Technique(s)

indirect ELISA: suitable
western blot: 1-5 μg/mL

Isotype

IgG2aκ

Numéro d'accès NCBI

NM_016270

Numéro d'accès UniProt

Q9Y5W3

Conditions d'expédition

dry ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... KLF2(10365)

Description générale

Kruppel like factor 2 (KLF2) is a tumor-suppressor gene, localized on human chromosome 19p13.11.

Immunogène

KLF2 (NP_057354, 263 a.a. ~ 350 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
SWPRKRTATHTCSYAGCGKTYTKSSHLKAHLRTHTGEKPYHCNWDGCGWKFARSDELTRHYRKHTGHRPFQCHLCDRAFSRSDHLALH

Actions biochimiques/physiologiques

Kruppel like factor 2 (KLF2) is crucial for lung functioning, cell differentiation, migration and tissue development. It modulates endothelial pro-inflammatory activation. The protein has roles in cardiovascular development and T-cell differentiation. Mutation in the gene encoding it has been associated with heritable pulmonary arterial hypertension.

Forme physique

Solution in phosphate buffered saline, pH 7.4

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Classe de danger pour l'eau (WGK)

WGK 1

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable

Certificats d'analyse (COA)

Recherchez un Certificats d'analyse (COA) en saisissant le numéro de lot du produit. Les numéros de lot figurent sur l'étiquette du produit après les mots "Lot" ou "Batch".

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

First identification of Kruppel-like factor 2 mutation in heritable pulmonary arterial hypertension.
Eichstaedt CA
Clinical Science (2017)
Kruppel-like factor 2 suppresses growth and invasion of gastric cancer cells in vitro and in vivo.
Mao QQ
Journal of Biological Regulators and Homeostatic Agents (2016)
Rafal Bartoszewski et al.
European journal of cell biology, 96(8), 758-766 (2017-10-19)
The role of microRNAs in controlling angiogenesis is recognized as a promising therapeutic target in both cancer and cardiovascular disorders. However, understanding a miRNA's pleiotropic effects on angiogenesis is a limiting factor for these types of therapeutic approaches. Using genome-wide
A study of the relationships between KLF2polymorphisms and body weight control in a French population
Aline Meirhaeghe
BMC Medical Genetics (2006)
W P Ries et al.
Annals of the Royal College of Surgeons of England, 101(8), 609-616 (2019-09-12)
Hypothermic machine perfusion, an organ preservation modality, involves flow of chilled preservation fluid through an allograft's vasculature. This study describes a simple, reproducible, human model that allows for interrogation of flow effects during ex vivo organ perfusion. Gonadal veins from

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique