Accéder au contenu
Merck
Toutes les photos(1)

Principaux documents

MSST0016

Sigma-Aldrich

SILuLite B2M beta-2-microglobulin human

recombinant, expressed in HEK 293 cells, MS Protein Standard

Synonyme(s) :

β-2-microglobulin, Mass spectrometry standard, B@M, Mass spectrometry standard, beta-2-microglobulin

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme


About This Item

Code UNSPSC :
23201100
Nomenclature NACRES :
NA.12

Source biologique

human

Niveau de qualité

Produit recombinant

expressed in HEK 293 cells

Essai

≥98% (SDS-PAGE)

Forme

lyophilized powder

Technique(s)

mass spectrometry (MS): suitable

Adéquation

suitable for mass spectrometry (internal calibrator)

Numéro d'accès UniProt

Température de stockage

−20°C

Informations sur le gène

human ... B2M(567)

Description générale

SILu Lite B2M is a recombinant human protein expressed in human 293 cells. It is a monomer of 119 amino acids (including C-terminal polyhistidine and flag tags), with a molecular weight of ~14 kDa. SILu Lite B2M is an analytical standard designed to be used as starting material for preparation of calibrators and controls in LC-MS applications.
Suggested Quantitative Analysis Parameters
(MRM settings provided for three suggested peptides)

Actions biochimiques/physiologiques

B2M is the light chain of the major histocompatibility class (MHC) I molecule expressed on the cell surface of all nucleated cells. Increased urinary B2M excretion has been observed to be an early marker of tubular injury in a number of settings, including nephrotoxicant exposure, cardiac surgery, and renal transplantation, preceding rises in serum creatinine by as many as 4−5 days. B2M may also serve as an early biomarker for AKI (Acute Kidney Injury).

Séquence

IQRTPKIQVYSRHPAENGKSNFLNCYVSGFHPSDIEVDLLKNGERIEKVEHSDLSFSKDWSFYLLYYTEFTPTEKDEYACRVNHVTLSQPKIVKWDRDMDYKDDDDKGHHHHHHHHGGQ

Forme physique

Supplied as a lyophilized powder containing phosphate buffered saline.

Informations légales

This product is licensed under U.S. Patent No. 7,396,688 and foreign counterparts from E. I. du Pont de Nemours and Company. The purchase of this product conveys to the buyer the nontransferable right to use the purchased amount of the product for research and development only, including services for a third party for consideration. The buyer cannot sell or otherwise transfer this product, its components or materials made using this product or its components to a third party. Information about licenses for excluded uses is available from: E. I. du Pont de Nemours and Company; Attn: Associate Director, Commercial Development; DuPont Experimental Station E268; 200 Powdermill Rd.; Wilmington, DE 19803; 1-877-881-9787 (voice), 1-302-695-1437 (fax), licensing@dupont.com.
SILu is a trademark of Sigma-Aldrich Co. LLC

Code de la classe de stockage

11 - Combustible Solids

Classe de danger pour l'eau (WGK)

WGK 2

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable


Faites votre choix parmi les versions les plus récentes :

Certificats d'analyse (COA)

Lot/Batch Number

Vous ne trouvez pas la bonne version ?

Si vous avez besoin d'une version particulière, vous pouvez rechercher un certificat spécifique par le numéro de lot.

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique