Accéder au contenu
Merck
Toutes les photos(4)

Key Documents

HPA023890

Sigma-Aldrich

Anti-CMTM4 antibody produced in rabbit

enhanced validation

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonyme(s) :

Anti-CKLF-like MARVEL transmembrane domain-containing protein 4, Anti-Chemokine-like factor superfamily member 4

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme
Toutes les photos(4)

About This Item

Code UNSPSC :
12352203
Numéro HPA (Human Protein Atlas):
HPA023890
Nomenclature NACRES :
NA.43

Source biologique

rabbit

Conjugué

unconjugated

Forme d'anticorps

affinity isolated antibody

Type de produit anticorps

primary antibodies

Clone

polyclonal

Gamme de produits

Prestige Antibodies® Powered by Atlas Antibodies

Forme

buffered aqueous glycerol solution

Espèces réactives

human

Validation améliorée

orthogonal RNAseq
Learn more about Antibody Enhanced Validation

Technique(s)

immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:20-1:50

Séquence immunogène

GEELDGFEGEASSTSMISGASSPYQPTTEPVSQRRGLAGLRCDPDYL

Numéro d'accès UniProt

Q8IZR5

Conditions d'expédition

wet ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... CMTM4(146223)

Description générale

CKLF (chemokine-like factor) like MARVEL transmembrane domain containing 4 (CMTM4) belongs to the CKLF like MARVEL transmembrane domain containing family (CMTM). The gene is located on human chromosome 16q21-q22.1. It is highly expressed in kidney, heart and brain.

Immunogène

CKLF-like MARVEL transmembrane domain-containing protein 4 recombinant protein epitope signature tag (PrEST)

Application

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.

Actions biochimiques/physiologiques

CKLF (chemokine-like factor) like MARVEL transmembrane domain containing 4 (CMTM4) functions as a regulator of cell cycle and division in HeLa cells. It acts as a tumor suppressor in clear cell renal cell carcinoma, when downregulated. The protein is involved in cell cycle growth. It regulates the protein programmed death-ligand 1 (PD-L1). It acts a target for microRNA-205 and enhances renal cell apoptosis.

Caractéristiques et avantages

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Liaison

Corresponding Antigen APREST73177

Forme physique

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Informations légales

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Classe de danger pour l'eau (WGK)

WGK 1

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable

Certificats d'analyse (COA)

Recherchez un Certificats d'analyse (COA) en saisissant le numéro de lot du produit. Les numéros de lot figurent sur l'étiquette du produit après les mots "Lot" ou "Batch".

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

CMTM4 is frequently downregulated and functions as a tumour suppressor in clear cell renal cell carcinoma
Li T, et al.
Journal of Experimental & Clinical Cancer Research, 34(1), 122-122 (2015)
MicroRNA-205 inhibits renal cells apoptosis via targeting CMTM4
Zhang H, et al.
Iranian Journal of Basic Medical Sciences, 18(10), 1020-1020 (2015)
Integrated analysis of copy number and loss of heterozygosity in primary breast carcinomas using high-density SNP array
Ching HC, et al.
International Journal of Oncology, 39(3), 621-633 (2011)
Identification of CMTM6 and CMTM4 as PD-L1 protein regulators
Mezzadra R, et al.
Nature, 549(7670), 106-106 (2017)
Markus Plate et al.
Molecules and cells, 29(4), 355-361 (2010-03-10)
Human CMTM is a novel gene family consisting of CKLF and CMTM1-8. CMTM4 is the most conserved gene and has three RNA splicing forms designated as CMTM4-v1, -v2 and -v3, but in many types of tissue and cell lines, only

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique