Accéder au contenu
Merck
Toutes les photos(3)

Key Documents

HPA021676

Sigma-Aldrich

Anti-RACK1 antibody produced in rabbit

affinity isolated antibody, buffered aqueous glycerol solution

Synonyme(s) :

Anti-Cell proliferation-inducing gene 21 protein, Anti-Guanine nucleotide-binding protein subunit beta-2-like 1, Anti-Guanine nucleotide-binding protein subunit beta-like protein 12.3, Anti-HLC-7, Anti-RACK1, Anti-Receptor for activated C kinase, Anti-Receptor of activated protein kinase C 1

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme
Toutes les photos(3)

About This Item

Code UNSPSC :
12352203
Numéro HPA (Human Protein Atlas):
HPA021676
Nomenclature NACRES :
NA.41

Source biologique

rabbit

Conjugué

unconjugated

Forme d'anticorps

affinity isolated antibody

Type de produit anticorps

primary antibodies

Clone

polyclonal

Forme

buffered aqueous glycerol solution

Espèces réactives

mouse, human

Technique(s)

immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
western blot: 0.04-0.4 μg/mL

Séquence immunogène

CVRFSPNSSNPIIVSCGWDKLVKVWNLANCKLKTNHIGHTGYLNTVTVSPDGSLCASGGKDGQAMLWDLNEGKHLYTLDG

Conditions d'expédition

wet ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... GNB2L1(10399)

Catégories apparentées

Description générale

Guanine nucleotide binding protein (G protein), β polypeptide 2-like 1 (GNB2L1) is a stably expressed housekeeping gene localized in alveolar macrophage and neutrophils. The gene has been predicted to encode a protein RACK1 (Receptor for activated C kinase 1). It is mapped on the telomeric position of chromosome 5q35.3.

Immunogène

Guanine nucleotide-binding protein subunit beta-2-like 1 recombinant protein epitope signature tag (PrEST)

Application

Anti-GNB2L1 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

Actions biochimiques/physiologiques

Guanine nucleotide binding protein (G protein), β polypeptide 2-like 1 (GNB2L1) is a scaffold protein highly involved in the binding and anchorage of protein kinase C. It has been predicted that GNB2L1 may act as a regulatory cofactor of multidrug resistance protein (MDR3/ABCB4) and is vital for the plasma membrane localization and translocation function of ABCB4.

Caractéristiques et avantages

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Liaison

Corresponding Antigen APREST74729

Forme physique

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Informations légales

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Classe de danger pour l'eau (WGK)

WGK 1

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable

Certificats d'analyse (COA)

Recherchez un Certificats d'analyse (COA) en saisissant le numéro de lot du produit. Les numéros de lot figurent sur l'étiquette du produit après les mots "Lot" ou "Batch".

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Motoyuki Otsuka et al.
PloS one, 6(9), e24359-e24359 (2011-09-22)
MicroRNAs (miRNAs) are important regulators of gene expression that control physiological and pathological processes. A global reduction in miRNA abundance and function is a general trait of human cancers, playing a causal role in the transformed phenotype. Here, we sought
Xiaozhu Zhang et al.
BMC molecular biology, 6, 4-4 (2005-02-22)
Reference genes, which are often referred to housekeeping genes, are frequently used to normalize mRNA levels between different samples. However the expression level of these genes may vary among tissues or cells, and may change under certain circumstances. Thus the
Yuki Ikebuchi et al.
Hepatology research : the official journal of the Japan Society of Hepatology, 39(11), 1091-1107 (2009-08-14)
Multidrug resistance protein 3 (MDR3/ABCB4), located on the bile canalicular membrane of hepatocytes, is responsible for the translocation of phosphatidylcholine across the plasma membrane, and its hereditary defect causes liver disorders, such as progressive familial intrahepatic cholestasis type 3. We
T Ishii et al.
The European respiratory journal, 27(2), 300-306 (2006-02-03)
The stability of housekeeping genes is critical when performing gene expression studies. To date, there have been no studies that look at the stability of commonly used housekeeping genes in alveolar macrophages. Expression levels may be affected by culture, stimulation
Shu Wang et al.
Molecular biology reports, 30(1), 53-60 (2003-04-12)
During a large-scale screen of a human fetal brain cDNA library, a novel human gene GNB2L1 encoding a novel RACK (receptor of activated protein kinase C) protein was isolated and sequenced. The cDNA is 1142 bp long and has a

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique