HPA018139

Anti-GOT2 antibody produced in rabbit

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

• Synonyme(s) : Anti-Aspartate aminotransferase, mitochondrial precursor, Anti-FABP-1, Anti-FABPpm, Anti-Fatty acid-binding protein, Anti-Glutamate oxaloacetate transaminase 2, Anti-Transaminase A, Anti-mAspAT
• Code UNSPSC : 12352203
• Numéro HPA (Human Protein Atlas): HPA018139
• Nomenclature NACRES : NA.41

Propriétés

• Source biologique: rabbit
• Conjugué: unconjugated
• Forme d'anticorps: affinity isolated antibody
• Type de produit anticorps: primary antibodies
• Clone: polyclonal
• Gamme de produits: Prestige Antibodies^® Powered by Atlas Antibodies
• Forme: buffered aqueous glycerol solution
• Espèces réactives: mouse, rat, human
• Validation améliorée: orthogonal RNAseq; Learn more about Antibody Enhanced Validation
• Technique(s): immunoblotting: 0.04-0.4 μg/mL; immunohistochemistry: 1:200-1:500
• Séquence immunogène: GFASGDGDKDAWAVRHFIEQGINVCLCQSYAKNMGLYGERVGAFTMVCKDADEAKRVESQLKILIRPMYSNPPLNGARIAAAILNTPDLRKQWLQEVKGMADRIIGMRTQLVSNLKKEGSTHNWQHITDQIGMFCFTGLKPEQVER
• Numéro d'accès UniProt: P00505
• Conditions d'expédition: wet ice
• Température de stockage: −20°C
• Modification post-traductionnelle de la cible: unmodified
• Informations sur le gène: human ... GOT2(2806)

Description

Description générale

The gene glutamate oxaloacetate transaminase-2 (GOT2) is located in human chromosome 16 (16q21). The protein is an aspartate aminotransfaerase (AST) enzyme. Two distinct forms of AST have been identified: a cytoplasmic (GOT1) and a mitochondrial isoform (GOT2). GOT2 has been identified within mitochondria and on the plasma membrane in HepG2 cells.

Immunogène

Aspartate aminotransferase, mitochondrial precursor recombinant protein epitope signature tag (PrEST)

Application

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies^® protocols and other useful information.

Anti-GOT2 antibody produced in rabbit has been used in western blotting and immunohistochemistry.

Actions biochimiques/physiologiques

The protein Glutamate oxaloacetate transaminase-2 (GOT2) participates in amino acid metabolism, converting aspartate and α-ketoglutarate (aKG) to oxaloacetate (OAC) and glutamate. GOT2 also provides a major route for reducing equivalents into mitochondria through its participation in the malate:asparte shuttle. GOT2K159 acetylation increases in human pancreatic tumors. It is shown to be involved in growth of human pancreatic adenocarcinoma. Long term ethanol exposure up-regulates GOT2 levels in the plasma membrane of HepG2 cells. The protein level increases in type2 diabetes patients post exercise training. Using mass spectroscopy and nuclear magnetic resonance approach decreased level of the enzyme was observed in brains from schizophrenia-induced rats and post-mortem schizophrenia patients. Proteomic analysis of Vastus lateralis muscle in mature and older women showed down-regulation of the protein in older women, indicating its involvement in muscle aging.

Caractéristiques et avantages

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Liaison

Corresponding Antigen APREST73325

Forme physique

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Informations légales

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informations sur la sécurité

• Code de la classe de stockage: 10 - Combustible liquids
• Classe de danger pour l'eau (WGK): WGK 1
• Point d'éclair (°F): Not applicable
• Point d'éclair (°C): Not applicable
• Équipement de protection individuelle: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)