Accéder au contenu
Merck
Toutes les photos(1)

Principaux documents

AV48665

Sigma-Aldrich

Anti-METTL1 antibody produced in rabbit

IgG fraction of antiserum

Synonyme(s) :

Anti-C12orf1, Anti-Methyltransferase like 1, Anti-TRM8, Anti-YDL201w

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme


About This Item

Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41

Source biologique

rabbit

Niveau de qualité

Conjugué

unconjugated

Forme d'anticorps

IgG fraction of antiserum

Type de produit anticorps

primary antibodies

Clone

polyclonal

Forme

buffered aqueous solution

Poids mol.

34 kDa

Espèces réactives

rat, goat, bovine, rabbit, guinea pig, dog, mouse, horse, human

Concentration

0.5 mg - 1 mg/mL

Technique(s)

western blot: suitable

Numéro d'accès NCBI

Numéro d'accès UniProt

Conditions d'expédition

wet ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... METTL1(4234)

Description générale

Anti-METTL1 antibody codes for methyltransferase like 1 that has an S-adenosylmethionine-binding motif. It is inactivated upon phosphorylation by PKB and RSK. A functional variant in METTL1, along with other genetic variants, has been associated with multiple sclerosis.
Rabbit Anti-METTL1 antibody recognizes bovine, human, mouse, and rat METTL1.

Immunogène

Synthetic peptide directed towards the middle region of human METTL1

Application

Rabbit Anti-METTL1 antibody is suitable for western blot applications at a concentration of 2.5 μg/ml.

Actions biochimiques/physiologiques

METTL1 contains a conserved S-adenosylmethionine-binding motif and is inactivated by phosphorylation.This gene is similar in sequence to the S. cerevisiae YDL201w gene. The gene product contains a conserved S-adenosylmethionine-binding motif and is inactivated by phosphorylation. Alternative splice variants encoding different protein isoforms have been described for this gene. A pseudogene has been identified on chromosome X.

Séquence

Synthetic peptide located within the following region: KGQLTKMFFLFPDPHFKRTKHKWRIISPTLLAEYAYVLRVGGLVYTITDV

Forme physique

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Classe de danger pour l'eau (WGK)

WGK 3

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable


Faites votre choix parmi les versions les plus récentes :

Certificats d'analyse (COA)

Lot/Batch Number

Vous ne trouvez pas la bonne version ?

Si vous avez besoin d'une version particulière, vous pouvez rechercher un certificat spécifique par le numéro de lot.

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Antonio Alcina et al.
Journal of medical genetics, 50(1), 25-33 (2012-11-20)
Several studies have highlighted the association of the 12q13.3-12q14.1 region with coeliac disease, type 1 diabetes, rheumatoid arthritis and multiple sclerosis (MS); however, the causal variants underlying diseases are still unclear. The authors sought to identify the functional variant of
Robert A Cartlidge et al.
The EMBO journal, 24(9), 1696-1705 (2005-04-30)
A substrate for protein kinase B (PKB)alpha in HeLa cell extracts was identified as methyltransferase-like protein-1 (METTL1), the orthologue of trm8, which catalyses the 7-methylguanosine modification of tRNA in Saccharomyces cerevisiae. PKB and ribosomal S6 kinase (RSK) both phosphorylated METTL1

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique