AV39663

Anti-MXD3 antibody produced in rabbit

affinity isolated antibody

• Synonyme(s) : Anti-MAD3, Anti-MAX dimerization protein 3, Anti-MGC2383
• Code UNSPSC : 12352203
• Nomenclature NACRES : NA.41

Propriétés

• Source biologique: rabbit
• Niveau de qualité: 100
• Conjugué: unconjugated
• Forme d'anticorps: affinity isolated antibody
• Type de produit anticorps: primary antibodies
• Clone: polyclonal
• Forme: buffered aqueous solution
• Poids mol.: 23 kDa
• Espèces réactives: horse, mouse, guinea pig, bovine, rat, human, rabbit, dog
• Concentration: 0.5 mg - 1 mg/mL
• Technique(s): western blot: suitable
• Numéro d'accès NCBI: NP_112590
• Numéro d'accès UniProt: Q9BW11
• Conditions d'expédition: wet ice
• Température de stockage: −20°C
• Modification post-traductionnelle de la cible: unmodified
• Informations sur le gène: human ... MXD3(83463)

Description

Description générale

MXD3 is a basic, helix-loop-helix transcription factor that belongs to the MAD family of proteins. This protein is involved in cerebellar development and GNP proliferation. Studies have reported that MXD3 is also required for the proliferation of DAOY medulloblastoma cells.
Rabbit Anti-MXD3 antibody binds to chicken, human, mouse, rat, bovine, zebrafish, and canine MXD3.

Immunogène

Synthetic peptide directed towards the N terminal region of human MXD3

Application

Rabbit Anti-MXD3 antibody is suitable for western blot applications at a concentration of 1 μg/ml.

Actions biochimiques/physiologiques

MXD3 contains 1 basic helix-loop-helix (bHLH) domain. It is a transcriptional repressor and binds with MAX to form a sequence-specific DNA-binding protein complex which recognizes the core sequence 5′-CAC[GA]TG-3′. Antagonizes MYC transcriptional activity by competing for MAX and suppresses MYC dependent cell transformation.

Séquence

Synthetic peptide located within the following region: MEPLASNIQVLLQAAEFLERREREAEHGYASLCPHRSPGPIHRRKKRPPQ

Forme physique

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informations sur la sécurité

• Code de la classe de stockage: 10 - Combustible liquids
• Classe de danger pour l'eau (WGK): WGK 2
• Point d'éclair (°F): Not applicable
• Point d'éclair (°C): Not applicable