Accéder au contenu
Merck
Toutes les photos(3)

Principaux documents

AV38234

Sigma-Aldrich

Anti-SOX4 antibody produced in rabbit

affinity isolated antibody

Synonyme(s) :

Anti-EVI16, Anti-SRY (sex determining region Y)-box 4

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme


About This Item

Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41

Source biologique

rabbit

Niveau de qualité

Conjugué

unconjugated

Forme d'anticorps

affinity isolated antibody

Type de produit anticorps

primary antibodies

Clone

polyclonal

Forme

buffered aqueous solution

Poids mol.

47 kDa

Espèces réactives

rabbit, rat, guinea pig, bovine, mouse, human, dog

Concentration

0.5 mg - 1 mg/mL

Technique(s)

immunohistochemistry: suitable
western blot: suitable

Numéro d'accès NCBI

Numéro d'accès UniProt

Conditions d'expédition

wet ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... SOX4(6659)

Description générale

SRγ (sex determining region γ) (SOX) are HMG box containing transcription factors that bind to the minor groove of DNA. Sox proteins family members regulate a variety of aspects of development. SRγ (sex determining region γ)-box 4 (SOX4, EVI16, SRγ) is required for differentiation and proliferation in many tissues, including various cancers. Sox4 acts in part by stabilizing β-catenin. Sox4 is required for lymphocyte development. It is an early factor in B-cell differentiation.
SRY (sex determining region Y) (SOX) are high-mobility-group (HMG) box containing transcription factors, that binds to the minor groove of DNA. SRY box 4 (SOX4) is a member of the SOX family of transcription factors. It is expressed majorly in normal and neoplastic gut tissues. SOX4 gene is located on human chromosome 6p22.3.

Spécificité

Anti-SOX4 polyclonal antibody reacts with bovine, canine, human, mouse, rat, zebrafish, and chicken SRγ (sex determining region γ)-box 4 proteins.

Immunogène

Synthetic peptide directed towards the N terminal region of human SOX4

Application

Anti-SOX4 polyclonal antibody is used to tag SRγ (sex determining region γ)-box 4 for detection and quantitation by Western blotting and in plasma by immunohistochemical (IHC) techniques. It is used as a probe to determine the roles of SRγ (sex determining region γ)-box 4 in cell differentiation and proliferation, such as B-cell differentitation.

Actions biochimiques/physiologiques

SRY box 4 (SOX4) is required for differentiation and proliferation in many tissues, including various cancers. It stabilizes β-catenin. Sox4 is essential for lymphocyte development. It acts as an early factor in B-cell differentiation. SOX4 is involved in the regulation of embryonic development and the determination of cell fate. It acts as a transcriptional regulator after forming syndecan binding protein (syntenin), a protein complex. SOX4 modulates the apoptosis pathway, which leads to cell death and tumorigenesis. It regulates downstream effects of parathyroid hormone (PTH) and PTH-related protein (PTHrP) in bone development.

Séquence

Synthetic peptide located within the following region: STASTGGKADDPSWCKTPSGHIKRPMNAFMVWSQIERRKIMEQSPDMHNA

Forme physique

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Classe de danger pour l'eau (WGK)

WGK 2

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable


Faites votre choix parmi les versions les plus récentes :

Certificats d'analyse (COA)

Lot/Batch Number

Vous ne trouvez pas la bonne version ?

Si vous avez besoin d'une version particulière, vous pouvez rechercher un certificat spécifique par le numéro de lot.

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Sox-4 messenger RNA is expressed in the embryonic growth plate and regulated via the parathyroid hormone/parathyroid hormone-related protein receptor in osteoblast-like cells
Reppe S, et al.
Journal of Bone and Mineral Research, 15(12), 2402-2412 (2000)
Shuang Pan et al.
Journal of biochemical and molecular toxicology, 36(1), e22910-e22910 (2021-12-21)
Exposure to high doses of anticancer drugs can induce the emergence of a subpopulation of weakly proliferative and drug-tolerant cells. Drug tolerance can reduce the benefits obtained from canonical treatment and reduce the survival rate of patients. Regulation of SRY-related
Syntenin-mediated regulation of Sox4 proteasomal degradation modulates transcriptional output
Beekman JM, et al.
Oncogene, 31(21), 2668-2679 (2012)
Microdeletions on 6p22. 3 are associated with mesomelic dysplasia Savarirayan type
Flottmann R, et al.
Journal of medical Genetics, 52(7), 476-483 (2015)
Sox4 is required for the survival of pro-B cells
Sun B, et al.
Journal of Immunology, 190(5), 2080-2089 (2013)

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique