AV37905

Anti-MyBBP1A antibody produced in rabbit

affinity isolated antibody

• Synonyme(s) : Anti-AL024407, Anti-AU019902, Anti-MyB binding protein (P160) 1a, Anti-P160, Anti-p160MBP, Anti-p67MBP
• Code UNSPSC : 12352203
• Nomenclature NACRES : NA.41

Propriétés

• Source biologique: rabbit
• Niveau de qualité: 100
• Conjugué: unconjugated
• Forme d'anticorps: affinity isolated antibody
• Type de produit anticorps: primary antibodies
• Clone: polyclonal
• Forme: buffered aqueous solution
• Poids mol.: 152 kDa
• Espèces réactives: mouse, human
• Concentration: 0.5 mg - 1 mg/mL
• Technique(s): western blot: suitable
• Numéro d'accès NCBI: NP_058056
• Numéro d'accès UniProt: Q7TPV4
• Conditions d'expédition: wet ice
• Température de stockage: −20°C
• Modification post-traductionnelle de la cible: unmodified
• Informations sur le gène: mouse ... Mybbp1a(18432)

Description

Description générale

MyB binding protein (P160) 1a (MyBBP1A), a c-myb proto-oncogene product (c-Myb)-interacting protein, is post-translationally processed to 67 kDa fragment (p67MBP). MyBBP1A is primarily expressed in the nucleoli. MyBBP1A which is associated with RNA Polymerase 1 complex and ribosome biogenesis machinery regulates rRNA metabolism and is believed to connect the process of ribosome biogenesis and Myb-dependent transcription to regulate/coordinate cell cycle progression and proliferation.

Spécificité

Anti-MyBBP1A polyclonal antibody reacts with human, rat, and mouse MyB binding protein (P160) 1a proteins.

Immunogène

Synthetic peptide directed towards the C terminal region of mouse Mybbp1a

Application

Anti-MyBBP1A polyclonal antibody is used to tag MyB binding protein (P160) 1a protein for detection and quantitation by Western blotting and in plasma by immunohistochemical (IHC) techniques. It is used as a probe to determine the roles of MyB binding protein (P160) 1a in the coordination and regulation of rRNA biosynthesis and ribosome biogenesis.

Actions biochimiques/physiologiques

Mybbp1a may activate or repress transcription via interactions with sequence specific DNA-binding proteins. Repression may be mediated at least in part by histone deacetylase activity.

Séquence

Synthetic peptide located within the following region: HSSGSNRLYDLYWQAMRMLGVQRPKSEKKNAKDIPSDTQSPVSTKRKKKG

Forme physique

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informations sur la sécurité

• Code de la classe de stockage: 10 - Combustible liquids
• Classe de danger pour l'eau (WGK): WGK 2
• Point d'éclair (°F): Not applicable
• Point d'éclair (°C): Not applicable