Accéder au contenu
Merck
Toutes les photos(2)

Key Documents

AV37145

Sigma-Aldrich

Anti-SREBF1 (AB1) antibody produced in rabbit

affinity isolated antibody

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme
Toutes les photos(2)

About This Item

Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41

Source biologique

rabbit

Niveau de qualité

100

Conjugué

unconjugated

Forme d'anticorps

affinity isolated antibody

Type de produit anticorps

primary antibodies

Clone

polyclonal

Forme

buffered aqueous solution

Poids mol.

125 kDa

Espèces réactives

mouse, human

Concentration

0.5 mg - 1 mg/mL

Technique(s)

western blot: suitable

Numéro d'accès NCBI

NP_035610

Numéro d'accès UniProt

Q9WTN3

Conditions d'expédition

wet ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

mouse ... SREBF1(20787)

Description générale

Sterol regulatory element-binding protein 1 (SREBP1) is a member of the basic helix-loop-helix (bHLH) family of transcription factors.

Immunogène

Synthetic peptide directed towards the N terminal region of mouse SREBF1

Actions biochimiques/physiologiques

Sterol regulatory element-binding protein 1 (SREBP1) regulates de novo lipogenesis. It can be used as a biomarker and a therapeutic target due to its function as an oncogene and a pro-proliferation factor in thyroid cancer. It bind to a sequence in the promoter of different genes, called sterol regulatory element-1 (SRE1). Upon cleavage of the precursor form of the protein, SREBF1 gets translated into the nucleus where it induces transcription of genes involved in glucose metabolism and fatty acid and lipid production. Sterols block cleavage of the precursor protein inhibiting transcription.
Sterol regulatory element-binding transcription factor 1 (SREBF1) binds to a sequence in the promoter of different genes, called sterol regulatory element-1 (SRE1). Upon cleavage of the precursor form of the protein, SREBF1 gets translated into the nucleus where it induces transcription of genes involved in glucose metabolism and fatty acid and lipid production. Sterols block cleavage of the precursor protein inhibiting transcription.

Séquence

Synthetic peptide located within the following region: DIEDMLQLINNQDSDFPGLFDAPYAGGETGDTGPSSPGANSPESFSSASL

Forme physique

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Classe de danger pour l'eau (WGK)

WGK 2

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable

Certificats d'analyse (COA)

Recherchez un Certificats d'analyse (COA) en saisissant le numéro de lot du produit. Les numéros de lot figurent sur l'étiquette du produit après les mots "Lot" ou "Batch".

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Cuilin Li et al.
Biomedicine & pharmacotherapy = Biomedecine & pharmacotherapie, 123, 109791-109791 (2019-12-31)
SREBP1 is a well-known transcript factor regulating lipogenesis. It has been reported to play an important role in tumor progress in recent years. However, the roles of SREBP1 in differentiated thyroid cancer (DTC) are uncertain. Based on this, we aimed
Delphine Eberlé et al.
Biochimie, 86(11), 839-848 (2004-12-14)
Sterol regulatory element binding proteins (SREBPs) are a family of transcription factors that regulate lipid homeostasis by controlling the expression of a range of enzymes required for endogenous cholesterol, fatty acid (FA), triacylglycerol and phospholipid synthesis. The three SREBP isoforms
Enrique M Toledo et al.
Cell reports, 31(5), 107601-107601 (2020-05-07)
Liver X receptors (LXRs) and their ligands are potent regulators of midbrain dopaminergic (mDA) neurogenesis and differentiation. However, the molecular mechanisms by which LXRs control these functions remain to be elucidated. Here, we perform a combined transcriptome and chromatin immunoprecipitation

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique