AV33617

Anti-CLDN9 antibody produced in rabbit

IgG fraction of antiserum

• Synonyme(s) : Anti-Claudin 9
• NACRES: NA.41
• UNSPSC Code: 12352203
• Conjugate: unconjugated
• Clone: polyclonal
• Application: WB
• Citations: 2

Propriétés

• biological source: rabbit
• conjugate: unconjugated
• antibody form: IgG fraction of antiserum
• antibody product type: primary antibodies
• clone: polyclonal
• form: buffered aqueous solution
• mol wt: 24 kDa
• species reactivity: mouse, horse, bovine, rat, guinea pig, human, dog
• concentration: 0.5 mg - 1 mg/mL
• technique(s): western blot: suitable
• NCBI accession no.: NP_066192
• UniProt accession no.: O95484
• shipped in: wet ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... CLDN9(9080)

Description

General description

Claudin-9, CLDN9, is a component of tight junction strands. CLDN9 is important for maintenance of sensory cells in the hearing organs. Mutations in the gene are associated with deafness.

Immunogen

Synthetic peptide directed towards the C terminal region of human CLDN9

Biochem/physiol Actions

CLDN9 is a member of claudin family. It is a four-transmembrane protein with WWCC motif, defined by W-X(17-22)-W-X(2)-C-X(8-10)-C.

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Other Notes

Synthetic peptide located within the following region: WAAAALLMLGGGLLCCTCPPPQVERPRGPRLGYSIPSRSGASGLDKRDYV

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informations sur la sécurité

• Classe de stockage: 10 - Combustible liquids
• wgk: WGK 3
• flash_point_f: Not applicable
• flash_point_c: Not applicable