AV31635

Anti-AHR (AB1) antibody produced in rabbit

IgG fraction of antiserum

• Synonyme(s) : Anti-Aryl hydrocarbon receptor
• Code UNSPSC : 12352203
• Nomenclature NACRES : NA.41

Propriétés

• Source biologique: rabbit
• Niveau de qualité: 100
• Conjugué: unconjugated
• Forme d'anticorps: IgG fraction of antiserum
• Type de produit anticorps: primary antibodies
• Clone: polyclonal
• Forme: buffered aqueous solution
• Poids mol.: 96 kDa
• Espèces réactives: rabbit, rat, mouse, human, dog, guinea pig
• Concentration: 0.5 mg - 1 mg/mL
• Technique(s): western blot: suitable
• Numéro d'accès NCBI: NP_001612
• Numéro d'accès UniProt: P35869
• Conditions d'expédition: wet ice
• Température de stockage: −20°C
• Modification post-traductionnelle de la cible: unmodified
• Informations sur le gène: human ... AHR(196)

Description

Description générale

Aryl Hydrocarbon receptor (AHR) is a transcription factor with an undetermined physiological receptor. AHR binds exogenous ligands such as polycyclic aromatic hydrocarbons, plant flavonoids, polyphenolics and indoles. It also binds tryptophan derivatives, tetrapyrroles and arachiconic acid metabolites. Aryl Hydrocarbon receptor is believed to be involved in differentiation processes such as hematopoiesis and the development of lymphoid systems, T-cells, neurons and hepatocytes. AHR activation leads to the induction of a plethora of xenobiotic metabolizing enzymes.

Rabbit polyclonal anti-AHR (AB1) antibody reacts with human, canine, mouse, rat, and rabbit aryl hydrocarbon receptors.

Immunogène

Synthetic peptide directed towards the N terminal region of human AHR

Application

Rabbit Anti-AHR (AB1) antibody can be used for western blot assays at a concentration of 2.5μg/ml.

Rabbit polyclonal anti-AHR (AB1) antibody is used to tag aryl hydrocarbon receptor for detection and quantitation by immunocytochemical and immunohistochemical (IHC) techniques. It is used as a probe to determine the presence and roles of aryl hydrocarbon receptor in differentiation, cell development, and adaptive response to xenobiotic stress.

Actions biochimiques/physiologiques

Aryl hydrocarbon receptor (AHR) is a ligand-activated transcription factor involved in the regulation of biological responses to planar aromatic hydrocarbons. AHR has been shown to regulate xenobiotic-metabolizing enzymes such as cytochrome P450. AHR ligands included a variety of aromatic hydrocarbons.

Séquence

Synthetic peptide located within the following region: MNSSSANITYASRKRRKPVQKTVKPIPAEGIKSNPSKRHRDRLNTELDRL

Forme physique

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informations sur la sécurité

• Code de la classe de stockage: 10 - Combustible liquids
• Classe de danger pour l'eau (WGK): WGK 3
• Point d'éclair (°F): Not applicable
• Point d'éclair (°C): Not applicable