SAB2108448
Anti-PCNA
IgG fraction of antiserum
Synonym(s):
Anti-AIT
Sign Into View Organizational & Contract Pricing
All Photos(4)
About This Item
UNSPSC Code:
12352203
NACRES:
NA.41
Recommended Products
biological source
rabbit
Quality Level
conjugate
unconjugated
antibody form
IgG fraction of antiserum
antibody product type
primary antibodies
clone
polyclonal
form
buffered aqueous solution
mol wt
29 kDa
species reactivity
bovine, rat, dog, mouse, human
concentration
0.5-1 mg/mL
technique(s)
immunoblotting: suitable
immunohistochemistry: suitable
accession no.
NM_002592
UniProt accession no.
shipped in
wet ice
storage temp.
−20°C
target post-translational modification
unmodified
Gene Information
human ... PCNA(5111)
General description
Proliferating cell nuclear antigen (PCNA), a nuclear protein, is expressed ubiquitously in mammals. This homotrimer protein is a doughnut-shaped molecule that is expressed at high levels in the thymus, bone marrow, fetal liver, and few cells of the small intestine and colon. PCNA is mainly located in the nucleus. The PCNA gene is a single-copy gene mapped to human chromosome 20p13.
Immunogen
Synthetic peptide directed towards the C terminal region of human PCNA
Application
Anti-PCNA has been used in:
- immunoblot (1:500) (1:1,000) (1:750)
- far-western analysis (1:1000)
- immunohistochemistry (1?:?50) (1:1000)
- proliferating cell nuclear antigen (PCNA) overlay assay (1:1,000)
Biochem/physiol Actions
Proliferating cell nuclear antigen (PCNA) participates in DNA replication and repair. It acts as an auxiliary factor of polymerase δ. It plays a key role in the maturation of Okazaki fragments. It can be used as a prognostic and diagnostic marker in chronic lymphoid leukemia (CLL). High expression of PCNA protein is seen in breast and duodenal cancers.
Sequence
Synthetic peptide located within the following region: LNFFTKATPLSSTVTLSMSADVPLVVEYKIADMGHLKYYLAPKIEDEEGS
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Not finding the right product?
Try our Product Selector Tool.
Storage Class Code
10 - Combustible liquids
WGK
WGK 3
Flash Point(F)
Not applicable
Flash Point(C)
Not applicable
Certificates of Analysis (COA)
Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
Elsayed I Salim et al.
Asian Pacific journal of cancer prevention : APJCP, 21(9), 2739-2750 (2020-09-29)
In search for a unique natural combination of highly active biological components for treatment against colon cancer, we used aqueous extract of Ascidia, Styela plicata (ASCex), a marine invertebrate depending on its richness of high levels of biologically active components
Weixin Hou et al.
Journal of inflammation research, 14, 7295-7313 (2022-01-08)
Acute-on-chronic liver failure (ACLF) is a critical disease with a high fatality rate. Immune dysfunction and inflammatory responses are key risk factors in ACLF. Pyroptosis is a form of programmed cell death characterized by the release of inflammatory cytokines, which
Farida E Elbassiouni et al.
Nanomaterials (Basel, Switzerland), 12(3) (2022-02-16)
Colorectal cancer is the third most common cancer. Because curcumin (CUR) has anti-inflammatory and anticancer properties, research has been undertaken to indicate that nanocurcumin compounds can be used to treat a variety of cancers. CUR in nanoform has been found
Qianling Ye et al.
Scientific reports, 14(1), 392-392 (2024-01-04)
The pathogenesis of Acute-on-chronic liver failure (ACLF) involves several forms of cell death, such as pyroptosis, apoptosis, and necroptosis, which consist of PANoptosis. To explore PANoptosis as a regulated cell death pathway in ACLF. Firstly, a bioinformatic strategy was used
PCNA (proliferating cell nuclear antigen)
Stoimenov I and Helleday T
Atlas of Genetics and Cytogenetics in Oncology and Haematology (2011)
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
Contact Technical Service