Skip to Content
Merck
All Photos(6)

Key Documents

HPA010775

Sigma-Aldrich

Anti-NECTIN4 antibody produced in rabbit

enhanced validation

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym(s):

LNIR antibody produced in rabbit, PRR4, PVRL4

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203
Human Protein Atlas Number:
NACRES:
NA.41

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human

enhanced validation

orthogonal RNAseq
Learn more about Antibody Enhanced Validation

technique(s)

immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:50-1:200

immunogen sequence

KLPCFYRGDSGEQVGQVAWARVDAGEGAQELALLHSKYGLHVSPAYEGRVEQPPPPRNPLDGSVLLRNAVQADEGEYECRVSTFPAGSFQARLRLRVLVPPLPSLNPGPAL

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... PVRL4(81607)

General description

PVRL4 (poliovirus receptor-related 4) belongs to a family of cell adhesion molecules called nectins, which in turn belong to immunoglobulin superfamily. It has a cytoplasmic tail domain, a single transmembrane domain, and three immunoglobulin-like domains in the extracellular region. Due to alternative splicing PVRL4 has two isoforms, with one lacking amino acids 412-436. In humans, this gene is localized to chromosome 1q23. Unlike other members of nectin family, PVRL4, also called nectin-4, is expressed mainly in embryo and placenta.

Immunogen

nectin cell adhesion molecule 4 recombinant protein epitope signature tag (PrEST)

Application

Anti-PVRL4 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

Biochem/physiol Actions

PVRL4 (poliovirus receptor-related 4) either forms a homodimer or a heterodimer with nectin-1, to facilitate cell-cell adhesion. It also aids the entry and lateral spread of measles virus, in primary epithelia lining the human airway. It is highly expressed in a variety of cancers such as, breast, lung and ovarian cancers. Its specificity for measles virus and expression in cancer cells makes it a potential oncolysis tool. Mutations in PVRL4 gene is associated with ectodermal dysplasia-syndactyly syndrome (EDSS), which is characterized by abnormalities in hair and tooth, alopecia, and cutaneous syndactyly. In keratinocytes of EDSS patients, mutated PVRL4 is incapable of forming a dimer with nectin-1. It is highly expressed in non-small cell lung cancers (NSCLC), and is associated with poor prognosis. Therefore, it might be involved in tumorigenesis of lung cancer, and has potential as a both marker and a therapeutic target for NSCLC.

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST72029

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 1

Personal Protective Equipment

dust mask type N95 (US), Eyeshields, Gloves

Certificates of Analysis (COA)

Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Rose Richardson et al.
PLoS genetics, 13(6), e1006828-e1006828 (2017-06-13)
Cleft palate is a common congenital disorder that affects up to 1 in 2500 live births and results in considerable morbidity to affected individuals and their families. The aetiology of cleft palate is complex with both genetic and environmental factors
Ingrid V Allen et al.
mSphere, 3(3) (2018-05-11)
Characterization of human measles cases is essential in order to better assess the data generated in model systems of morbillivirus infection. To this end, we collected formalin-fixed tissue samples from 23 natural measles cases from different areas in the world
Abolfazl Razzaghdoust et al.
BioMed research international, 2021, 2670573-2670573 (2021-01-26)
Antibody-drug conjugate therapy has attracted considerable attention in recent years. Since the selection of appropriate targets is a critical aspect of antibody-drug conjugate research and development, a big data research for discovery of candidate targets per tumor type is outstanding
Hideki Izumi et al.
Surgery today, 45(4), 487-494 (2015-02-19)
Nectins are cell adhesion molecules that regulate the formation of adherens junctions and are linked with E-cadherin-based cell-cell adherens junctions. In pancreatic cancer, the expression of E-cadherin and nectins is considered to be related to metastasis, invasion and prognosis. We
Abolfazl Razzaghdoust et al.
Iranian journal of basic medical sciences, 24(12), 1650-1655 (2022-04-19)
Patient-derived xenograft (PDX) models have become a valuable tool to evaluate chemotherapeutics and investigate personalized cancer treatment options. The role of PDXs in the study of bladder cancer, especially for improvement of novel targeted therapies, continues to expand. In this

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service