Skip to Content
Merck
All Photos(8)

Key Documents

HPA005456

Sigma-Aldrich

Anti-ARID1A antibody produced in rabbit

enhanced validation

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym(s):

ARID1A Antibody - Anti-ARID1A antibody produced in rabbit, Arid1A Antibody, Anti-B120 antibody produced in rabbit, Anti-BAF250, Anti-BAF250a, Anti-C10rf4, Anti-C1orf4, Anti-P270, Anti-SMARCF1

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203
Human Protein Atlas Number:
NACRES:
NA.41

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human

enhanced validation

RNAi knockdown
Learn more about Antibody Enhanced Validation

technique(s)

immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:200-1:500
western blot: 0.04-0.4 μg/mL

UniProt accession no.

application(s)

research pathology

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... ARID1A(8289)

General description

AT-rich interactive domain-containing protein 1A (ARID1A) is a member of ARID family, which forms a subunit of SWI/SNF (SWItch/Sucrose NonFermentable) chromatin-remodeling complex. It is a tumor suppressor gene, and binds to DNA in a non-sequence specific manner. This gene is located in the chromosomal region 1p36.11. AIRD1A is also called BAF250a, which is one of the two highly conserved isoforms of BAF250/AIRD1. It is a trithorax group (TrxG) protein, and is highly expressed in pre-implantation embryo and embryonic stem (ES) cells.

Immunogen

AT-rich interactive domain-containing protein 1A recombinant protein epitope signature tag (PrEST)

Sequence
PGLGNVAMGPRQHYPYGGPYDRVRTEPGIGPEGNMSTGAPQPNLMPSNPDSGMYSPSRYPPQQQQQQQQRHDSYGNQFSTQGTPSGSPFPSQQTTMYQQQQQNYK

Application

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.
Anti-ARID1A antibody produced in rabbit has been used in immunohistochemistry.

Biochem/physiol Actions

AT-rich interactive domain 1A (ARID1A) interacts with Brahma-related gene-1 (BRG1) adenosine triphosphate and forms the SWI/SNF complex. It targets the SWI/SNF complex to the specific genes, and helps bind it to the DNA in a sequence non-specific manner. During gastrulation, it plays an essential role in proper germ-layer formation. It also helps maintain the embryonic stem (ES) cell stage and is responsible for the differentiation of cardiomyocytes. Because AIRD1A acts as a tumor suppressor gene, its inactivation has been implicated in various cancers, such as epithelial, ovarian and endometrial carcinomas. It is also linked to gastric cancer and has potential as a marker for the prognosis of patients with early stage gastric cancer.

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST70748

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 1

Personal Protective Equipment

dust mask type N95 (US), Eyeshields, Gloves

Certificates of Analysis (COA)

Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Xiao-Qiang Guo et al.
Yi chuan = Hereditas, 35(3), 255-261 (2013-04-12)
The mammalian SWI/SNF complex is one of ATP-dependent chromatin-remodeling complexes, which plays important roles in cell proliferation, differentiation, development and tumor suppression. ARID1A (AT-rich interactive domain-containing protein 1A) is a large subunit of SWI/SNF complex, and also an ARID family
Sheila F Faraj et al.
Human pathology, 46(5), 761-766 (2015-03-18)
ARID1A, a member of the chromatin remodeling genes family, has been suggested as a novel tumor suppressor gene in gynecologic malignancies. However, its role in penile cancer has yet to be determined. This study assesses the immunohistochemical expression of ARID1A
Application of ARID1A to murine formalin-fixed paraffin embedded tissue using immunohistochemistry
Howat W, et al.
F1000Research, 3 (2014)
Hiroyuki Abe et al.
International journal of clinical and experimental pathology, 8(3), 2763-2770 (2015-06-06)
AT-rich interactive domain 1A (ARID1A) is a subunit of the Switch/Sucrose non-fermentable (SWI/SNF) chromatin remodeling complex. Recently, genome-wide whole exome sequencing revealed frequent mutations of ARID1A in hepatocellular carcinoma, but clinicopathological significance of ARID1A alteration has not been clarified yet.
Yuriko Uehara et al.
PloS one, 10(6), e0128066-e0128066 (2015-06-05)
Ovarian clear cell carcinoma (CCC) is generally associated with chemoresistance and poor clinical outcome, even with early diagnosis; whereas high-grade serous carcinomas (SCs) and endometrioid carcinomas (ECs) are commonly chemosensitive at advanced stages. Although an integrated genomic analysis of SC

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service