Skip to Content
Merck
All Photos(2)

Key Documents

SAB2106448

Sigma-Aldrich

Anti-SIX1 antibody produced in rabbit

affinity isolated antibody

Sign Into View Organizational & Contract Pricing

Select a Size

100 μL
4.050,00 kr.

4.050,00 kr.


Please contact Customer Service for Availability


Select a Size

Change View
100 μL
4.050,00 kr.

About This Item

UNSPSC Code:
12352203
NACRES:
NA.43

4.050,00 kr.


Please contact Customer Service for Availability

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

32 kDa

species reactivity

human, guinea pig, rat, dog, horse, mouse, bovine, sheep, rabbit

concentration

0.5 mg - 1 mg/mL

technique(s)

immunohistochemistry: suitable
western blot: suitable

NCBI accession no.

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... SIX1(6495)
mouse ... Six1(20471)

General description

Sine oculis homeobox homolog 1 (SIX1) is a transcription factor, having a homeodomain. It is part of the homeoprotein family and is expressed during embryogenesis. The gene encoding this protein is localized on human chromosome 14q23.1.

Immunogen

The immunogen for anti-SIX1 antibody: synthetic peptide derected towards the N terminal of human SIX1

Biochem/physiol Actions

Sine oculis homeobox homolog 1 (SIX1) enhances the rate of proliferation of cells and their survival. It has a role in organogenesis and has been linked to several malignancies.

Sequence

Synthetic peptide located within the following region: ERLGRFLWSLPACDHLHKNESVLKAKAVVAFHRGNFRELYKILESHQFSP

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 3

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable


Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Inhibition of Six1 affects tumour invasion and the expression of cancer stem cell markers in pancreatic cancer
Tristan L, et al.
BMC Cancer, 17(1), 249-249 (2017)
The role of Six1 signaling in paclitaxel-dependent apoptosis in MCF-7 cell line
Armat MA, et al.
Bosnian Journal of Basic Medical Sciences / Udruzenje Basicnih Mediciniskih Znanosti = Association of Basic Medical Sciences, 16(1), 28-28 (2016)
Aberrant expression of homeobox gene SIX1 in Hodgkin lymphoma.
Nagel S, et al.
Oncotarget, 6(37), 40112-40112 (2015)
Baowei Li et al.
Medical science monitor : international medical journal of experimental and clinical research, 24, 2271-2279 (2018-04-16)
BACKGROUND The objective of this study was to explore the role of SIX1 in paclitaxel (TAX) resistance of HepG2 cells via reactive oxygen species (ROS) and autophagy pathway. MATERIAL AND METHODS Hepatoma cell line HepG2 was treated with SIX1 knockdown
Jienan Kong et al.
International journal of clinical and experimental pathology, 7(6), 3018-3027 (2014-07-18)
High expression levels of the human sineoculis homeobox homolog 1 (SIX1) gene have been correlated with numerous human malignancies. The SIX1 protein is involved in chromatin reconstruction and gene transcription, and plays an important role in cell apoptosis. This study

Questions

Reviews

No rating value

Active Filters

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service