Fli-1 proto-oncogene, ETS transcription factor (FLI1) is encoded by the gene mapped to human chromosome 11. The encoded protein belongs to the ETS family of transcription factors. FLI1 consists of ETS DNA-binding domain at its C-terminal end and is mainly expressed in hematopoietic and vascular endothelial cells.
Immunogen
Synthetic peptide directed towards the middle region of human FLI1
Application
Anti-FLI1 antibody produced in rabbit has been used in chromatin immunoprecipitation.
Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.Chromatin immunoprecipitation (1 paper)
Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below. Chromatin immunoprecipitation (1 paper)
Biochem/physiol Actions
Fli-1 proto-oncogene, ETS transcription factor (FLI1) acts as a sequence-specific transcriptional activator. It might be implicated in the development of both the haematopoietic and vascular systems. In addition, it also plays a vital role in megakaryopoiesis and platelet function. FLI1 functions as a regulator of essential midkine (MK) genes. Mutations in FLI1 is associated with the pathogenesis of Paris-Trousseau syndrome and congenital thrombocytopenia.
Sequence
Synthetic peptide located within the following region: FDFHGIAQALQPHPTESSMYKYPSDISYMPSYHAHQQKVNFVPPHPSSMP
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Proceedings of the National Academy of Sciences of the United States of America, 118(31) (2021-08-01)
A network of molecular factors drives the development, differentiation, and maintenance of endothelial cells. Friend leukemia integration 1 transcription factor (FLI1) is a bona fide marker of endothelial cells during early development. In zebrafish Tg( f li1:EGFP) y1 , we
Genotoxic stress inhibits Ewing sarcoma cell growth by modulating alternative pre-mRNA processing of the RNA helicase DHX9.
Fidaleo M
Oncotarget, 6(31), 31740-31757 (2015)
Macrothrombocytopenia and dense granule deficiency associated with FLI1 variants: ultrastructural and pathogenic features.
Saultier P
Haematologica, 102(6), 1006-1016 (2017)
EWS, but not EWS-FLI-1, is associated with both TFIID and RNA polymerase II: interactions between two members of the TET family, EWS and hTAFII68, and subunits of TFIID and RNA polymerase II complexes.
Bertolotti A
Molecular and Cellular Biology, 18(3), 1489-1497 (1998)
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.