SAB1404661

Monoclonal Anti-BAZ1B, (C-terminal) antibody produced in mouse

clone 5E9, ascites fluid

• Synonym(s): WBSCR10, WBSCR9, WSTF
• UNSPSC Code: 12352203
• NACRES: NA.43

Properties

• biological source: mouse
• conjugate: unconjugated
• antibody form: ascites fluid
• antibody product type: primary antibodies
• clone: 5E9, monoclonal
• mol wt: antigen ~37.11 kDa
• species reactivity: human
• technique(s): indirect ELISA: suitable
• isotype: IgG2aκ
• NCBI accession no.: NM_023005
• UniProt accession no.: Q9UIG0
• shipped in: dry ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... BAZ1B(9031)

Description

General description

This gene encodes a member of the bromodomain protein family. The bromodomain is a structural motif characteristic of proteins involved in chromatin-dependent regulation of transcription. This gene is deleted in Williams-Beuren syndrome, a developmental disorder caused by deletion of multiple genes at 7q11.23. (provided by RefSeq)

Immunogen

BAZ1B (NP_075381, 1384 a.a. ~ 1483 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MDFQTVQNKCSCGSYRSVQEFLTDMKQVFTNAEVYNCRGSHVLSCMVKTEQCLVALLHKHLPGHPYVRRKRKKFPDRLAEDEGDSEPEAVGQSRGRRQKK

Physical form

Clear solution

Safety Information

• Storage Class Code: 11 - Combustible Solids
• WGK: WGK 1
• Flash Point(F): Not applicable
• Flash Point(C): Not applicable