Skip to Content
Merck
All Photos(3)

Key Documents

HPA036103

Sigma-Aldrich

Anti-PID1 antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym(s):

Anti-FLJ20701, Anti-NYGGF4, Anti-phosphotyrosine interaction domain containing 1

Sign Into View Organizational & Contract Pricing

Select a Size

100 μL
4.340,00 kr.

4.340,00 kr.


Please contact Customer Service for Availability


Select a Size

Change View
100 μL
4.340,00 kr.

About This Item

UNSPSC Code:
12352203
Human Protein Atlas Number:
NACRES:
NA.43

4.340,00 kr.


Please contact Customer Service for Availability

biological source

rabbit

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human

technique(s)

immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:200-1:500

immunogen sequence

VSPNIFAWVYREINDDLSYQMDCHAVECESKLEAKKLAHAMMEAFRKTFHSMKSDGRIHSNSSSEEVSQELESDDG

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... PID1(55022)

General description

NYGGF4 (phosphotyrosine interaction domain containing 1, PID1) is linked to obesity-associated insulin resistance (IR) wherein overexpression of NYGGF4 in cells such as 3T3-L1 adipocytes decreases mitochondrial mass, mitochondrial DNA, and intracellular ATP synthesis. NYGGF4 effects on IR may be reversed by metformin through activating IRS-1/PI3K/Akt and AMPK-PGC1-α pathways.
Rabbit polyclonal anti-PID1 antibody reacts with human phosphotyrosine interaction domain containing 1(NYGGF4).

Immunogen

phosphotyrosine interaction domain containing 1 recombinant protein epitope signature tag (PrEST)

Application

Rabbit polyclonal anti-PID1 antibody is used to tag phosphotyrosine interaction domain containing 1 (NYGGF4) for detection and quantitation by immunocytochemical and immunohistochemical (IHC) techniques. It is used as a probe to determine the presence and roles of phosphotyrosine interaction domain containing 1 (NYGGF4) in obesity-associated insulin resistance.

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST79146

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 1

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable


Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Jingying Xu et al.
Scientific reports, 7(1), 835-835 (2017-04-13)
Phosphotyrosine Interaction Domain containing 1 (PID1; NYGGF4) inhibits growth of medulloblastoma, glioblastoma and atypical teratoid rhabdoid tumor cell lines. PID1 tumor mRNA levels are highly correlated with longer survival in medulloblastoma and glioma patients, suggesting their tumors may have been
null
Chunyan Yin et al.
PloS one, 14(4), e0214606-e0214606 (2019-04-17)
The aim of this study was to investigate the effect of phosphotyrosine interaction domain containing 1 (PID1) on the insulin-induced activation of the AKT (protein kinase B)/protein kinase A (PKA)/hormone-sensitive lipase (HSL) pathway and lipolysis. Sprague-Dawley rats were fed either
Sabeera Bonala et al.
Molecular endocrinology (Baltimore, Md.), 27(9), 1518-1535 (2013-08-10)
Obesity is associated with insulin resistance and abnormal peripheral tissue glucose uptake. However, the mechanisms that interfere with insulin signaling and glucose uptake in human skeletal muscle during obesity are not fully characterized. Using microarray, we have identified that the

Questions

Reviews

No rating value

Active Filters

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service