Skip to Content
Merck
All Photos(1)

Documents

HPA021126

Sigma-Aldrich

Anti-ITCH antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym(s):

Anti-AIP4, Anti-Atrophin-1-interacting protein 4, Anti-E3 ubiquitin-protein ligase Itchy homolog, Anti-Itch, Anti-NAPP1, Anti-NFE2-associated polypeptide 1

Sign Into View Organizational & Contract Pricing


About This Item

MDL number:
UNSPSC Code:
12352203
Human Protein Atlas Number:
NACRES:
NA.43

biological source

rabbit

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human

technique(s)

immunohistochemistry: 1:50- 1:200

immunogen sequence

LKSDVLLGTAALDIYETLKSNNMKLEEVVVTLQLGGDKEPTETIGDLSICLDGLQLESEVVTNGETTCSENGVSLCLP

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... ITCH(83737)

General description

Itchy E3 ubiquitin protein ligase (ITCH) is characterized by an N- terminal protein kinase C-related C2 domain, four WW domains and a C-terminal homologous to the E6-associated protein carboxyl-terminus (HECT) ubiquitin protein ligase domain.
The gene ITCH (E3 ubiquitin-protein ligase Itchy homolog) is mapped to human chromosome 20q11.22. It belongs to Nedd4 (neural precursor cell expressed developmentally down-regulated protein 4) family of E3 ubiquitin ligases.

Immunogen

E3 ubiquitin-protein ligase Itchy homolog recombinant protein epitope signature tag (PrEST)

Application

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.

Biochem/physiol Actions

ITCH (E3 ubiquitin-protein ligase Itchy homolog) is responsible for ubiquitination of CXCR4 (C-X-C chemokine receptor type 4) and ubiquitin binding protein Hrs (hepatocyte growth factor regulated tyrosine kinase substrate). ITCH also mediates ubiquitination of NF-E2 (nuclear factor, erythroid-derived 2) and thereby inhibits its transactivation function. Absence of ITCH leads to syndromic multisystem autoimmune disease.
Itchy E3 ubiquitin protein ligase (ITCH) in association with Ebola virus VP40 (eVP40), aids in virus-like particles (VLP) and virus budding. Overexpression of the gene is associated with the development of thyroid tumors, mainly anaplastic thyroid carcinoma (ATC).

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST73990

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 1

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable


Certificates of Analysis (COA)

Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Adriano Marchese et al.
Developmental cell, 5(5), 709-722 (2003-11-07)
Ubiquitination of the chemokine receptor CXCR4 serves as a targeting signal for lysosomal degradation, but the mechanisms mediating ubiquitination and lysosomal sorting remain poorly understood. Here we report that the Nedd4-like E3 ubiquitin ligase AIP4 mediates ubiquitination of CXCR4 at
ITCH E3 Ubiquitin Ligase Interacts with Ebola Virus VP40 To Regulate Budding
Han Z, et al.
Journal of virology, 90(20), 9163-9171 (2016)
Tung-Liang Lee et al.
Biochemical and biophysical research communications, 375(3), 326-330 (2008-08-23)
The hematopoietic-specific transcription factor p45/NF-E2 is an important transcriptional activator in the erythroid and megakaryocytic lineages. We describe the first in vivo evidence for the interaction between p45/NF-E2 and the E3 ubiquitin ligase Itch, and the subsequent ubiquitination of p45/NF-E2
Naomi J Lohr et al.
American journal of human genetics, 86(3), 447-453 (2010-02-23)
Ubiquitin ligases play an important role in the regulation of the immune system. Absence of Itch E3 ubiquitin ligase in mice has been shown to cause severe autoimmune disease. Using autozygosity mapping in a large Amish kindred, we identified a
Takaya Ishihara et al.
Cancer science, 99(10), 1940-1949 (2008-11-20)
Anaplastic thyroid carcinoma (ATC) is one of the most virulent of all human malignancies, with a mean survival time among patients of less than 1 year after diagnosis. To date, however, cytogenetic information on this disease has been very limited.

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service