Skip to Content
Merck
All Photos(3)

Key Documents

HPA018527

Sigma-Aldrich

Anti-WRB antibody produced in rabbit

enhanced validation

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym(s):

Anti-Congenital heart disease 5 protein, Anti-Tryptophan-rich protein

Sign Into View Organizational & Contract Pricing

Select a Size

100 μL
4.340,00 kr.

4.340,00 kr.


Please contact Customer Service for Availability


Select a Size

Change View
100 μL
4.340,00 kr.

About This Item

UNSPSC Code:
12352203
Human Protein Atlas Number:
NACRES:
NA.41

4.340,00 kr.


Please contact Customer Service for Availability

biological source

rabbit

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human

enhanced validation

recombinant expression
Learn more about Antibody Enhanced Validation

technique(s)

immunohistochemistry: 1:50-1:200
western blot: 0.04-0.4 μg/mL

immunogen sequence

SFMSRVLQKDAEQESQMRAEIQDMKQELSTVNMMDEFARYARLERKINKMTDKLKTHVKARTAQLAKIK

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... WRB(7485)

General description

The gene WRB (tryptophan-rich basic protein) is mapped to human chromosome 21q22.3. It is also popularly called as CHD5 (congenital heart disease 5 protein). WRB is widely expressed in adult and fetal tissues, with higher expression in the heart, brain, liver, skeletal muscle and pancreas. The protein is localized mainly in the nucleus. However, WRB has also been shown to associate with endoplasmic reticulum membrane.

Immunogen

Tryptophan-rich protein recombinant protein epitope signature tag (PrEST)

Application

Anti-WRB antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

Biochem/physiol Actions

Tryptophan-rich basic protein (WRB) interacts with ATPase ASNA1 (Arsenite-stimulated ATPase) and recruits it to the endoplasmic reticulum (ER) membrane, thereby mediating insertion of tail-anchored proteins into the ER membrane. In Xenopus loss of WRB affects cell movements associated with cardiac formation. WRB interacts with cardiac transcription factor Castor (CASZ1). CHD5-CASZ1 interaction is necessary for cardiac morphogenesis in Xenopus.

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST73085

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 1

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Personal Protective Equipment

dust mask type N95 (US), Eyeshields, Gloves

Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Kenji Murata et al.
Development, growth & differentiation, 51(2), 95-107 (2009-02-12)
The congenital heart disease 5 (CHD5)/tryptophan rich basic protein (WRB) is a protein containing a tryptophan-rich carboxy-terminal region, which was discovered in the human fetal heart. In humans, this CHD5/WRB is located between the markers ACTL5-D21S268 within the Down syndrome
A Egeo et al.
Human genetics, 102(3), 289-293 (1998-04-17)
Congenital heart disease (CHD) affects over 40% of Down syndrome (DS) patients. The region proposed to contain the gene(s) for DS CHD has been restricted to 21q22.2-22.3, from D21S55 to MX1. The identification and functional characterization of the genes mapping
Fabio Vilardi et al.
Journal of cell science, 124(Pt 8), 1301-1307 (2011-03-30)
Tail-anchored (TA) proteins are post-translationally targeted to and inserted into the endoplasmic reticulum (ER) membrane through their single C-terminal transmembrane domain. Membrane insertion of TA proteins in mammalian cells is mediated by the ATPase TRC40/Asna1 (Get3 in yeast) and a
Stephen Sojka et al.
Development (Cambridge, England), 141(15), 3040-3049 (2014-07-06)
The identification and characterization of the cellular and molecular pathways involved in the differentiation and morphogenesis of specific cell types of the developing heart are crucial to understanding the process of cardiac development and the pathology associated with human congenital

Questions

Reviews

No rating value

Active Filters

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service