Skip to Content
Merck
All Photos(5)

Documents

HPA006426

Sigma-Aldrich

Anti-RAPGEF1 antibody produced in rabbit

enhanced validation

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym(s):

Anti-C3G protein, Anti-CRK SH3-binding GNRP, Anti-Guanine nucleotide-releasing factor 2, Anti-Rap guanine nucleotide exchange factor 1

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203
Human Protein Atlas Number:
NACRES:
NA.43

biological source

rabbit

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human

enhanced validation

recombinant expression
Learn more about Antibody Enhanced Validation

technique(s)

immunoblotting: 0.04-0.4 μg/mL
immunohistochemistry: 1:50-1:200

immunogen sequence

SWLEEKEKEVVSALRYFKTIVDKMAIDKKVLEMLPGSASKVLEAILPLVQNDPRIQHSSALSSCYSRVYQSLANLIRWSDQVMLEGVNSEDKEMVTTVKGVIKAVLDGVKELVRLTIEKQGRPSPTSPVKPSSPASK

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... RAPGEF1(2889)

General description

RAPGEF1 (Rap guanine nucleotide exchange factor 1) is a guanine nucleotide exchange factor, and the gene is localized to human chromosome 9q34.3. This protein has a ubiquitous expression pattern, and resides as a complex with Crk (CT10 regulator of kinase) family of proteins in the cytoplasm.
Rap guanine nucleotide exchange factor 1 is a protein encoded by the RAPGEF1 gene in humans. It is referred to as C3G and GRF2. It is mapped to human chromosome 9q34.3. It releases GDP from the inactive Rap1 protein. It may facilitate activation by binding to GTP. This protein acts as an exchange factor for Ras family of small GTPases.

Immunogen

Rap guanine nucleotide exchange factor 1 recombinant protein epitope signature tag (PrEST)

Application

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.

Biochem/physiol Actions

RAPGEF1 (Rap guanine nucleotide exchange factor 1) is responsible for the exchange of GDP with GTP from Rap1 protein, thus, activating it. Rap1 (Ras-related protein 1) protein in turn is involved in processes such as, differentiation, proliferation and apoptosis. It is up-regulated in small cell lung cancers, where it leads to aberrations in CRK (CT10 regulator of kinase)-Rap1 signaling pathway, and thus, acts as an oncogene. This protein participates in multiple signaling cascades, such as the growth factor-mediated and GPCR (G-protein coupled receptor)-mediated. It participates in T-cell and B-cell activation and cell adhesion. Its interaction with Rap1 results in secretion of MMP (matrix metalloproteinase)-2 and MMP-9 in serous ovarian cancer. This protein is thus, involved in metastasis of epithelial ovarian cancer (EOC).

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST70078

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 1

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Personal Protective Equipment

dust mask type N95 (US), Eyeshields, Gloves

Certificates of Analysis (COA)

Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

S Takai et al.
Human genetics, 94(5), 549-550 (1994-11-01)
C3G, a human guanine nucleotide releasing protein for Ras protein, was mapped to human chromosome 9q34.3 by fluorescence in situ hybridization with R-banded chromosomes. C3G was originally identified as one of the CRK-binding proteins, similar to c-abl (9q34.1). Our result
Johanna Samuelsson et al.
International journal of oncology, 38(6), 1575-1577 (2011-03-15)
RAPGEF1 (also known as C3G and GRF2) is a guanine nucleotide exchange factor that releases GDP from the inactive Rap1 protein, facilitating its subsequent activation by the binding of GTP. Rap1 plays regulatory roles in proliferation, differentiation and apoptosis. Amplification
Kunal Dayma et al.
Biochimica et biophysica acta, 1813(3), 456-465 (2011-01-13)
Cytoskeletal remodeling is responsible for cell plasticity and facilitates differentiation, motility and adherence related functions. C3G (RAPGEF1), an exchange factor for Ras family of small GTPases, regulates cytoskeletal reorganization to induce filopodia in epithelial cells and neurite growth in neuroblastoma
Vegesna Radha et al.
BMC cell biology, 5, 31-31 (2004-08-24)
The guanine nucleotide exchange factor C3G (RapGEF1) along with its effector proteins participates in signaling pathways that regulate eukaryotic cell proliferation, adhesion, apoptosis and embryonic development. It activates Rap1, Rap2 and R-Ras members of the Ras family of GTPases. C3G
Ya-Ling Che et al.
Cancer letters, 359(2), 241-249 (2015-01-27)
Complete resection is pivotal to improve survival to epithelial ovarian cancer (EOC). Crk SH3-domain-binding guanine nucleotide-releasing factor (C3G) is involved in multiple signaling pathways and it has opposite roles in different cancers. The present study aimed to identify C3G expression

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service