Skip to Content
Merck
All Photos(1)

Key Documents

AV49111

Sigma-Aldrich

Anti-C3ORF64 antibody produced in rabbit

affinity isolated antibody

Synonym(s):

Anti-AER61, Anti-FLJ13078, Anti-FLJ33770, Anti-FLJ41219, Anti-MGC34132

Sign Into View Organizational & Contract Pricing

Select a Size

100 μL
3.080,00 kr.

3.080,00 kr.


Please contact Customer Service for Availability


Select a Size

Change View
100 μL
3.080,00 kr.

About This Item

UNSPSC Code:
12352203
NACRES:
NA.41

3.080,00 kr.


Please contact Customer Service for Availability

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

52 kDa

species reactivity

human, guinea pig, mouse, rat, horse, dog, rabbit, bovine

concentration

0.5 mg - 1 mg/mL

technique(s)

western blot: suitable

NCBI accession no.

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

Immunogen

Synthetic peptide directed towards the C terminal region of human C3orf64

Application

Anti-C3ORF64 antibody produced in rabbit is suitable for western blotting at a concentration of 1.0μg/ml.

Biochem/physiol Actions

C3ORF64 is popular as EGF domain-specific O-linked N-acetylglucosamine (GlcNAc) transferase (EOGT; AOS4) is an O-GlcNAc transferase located in the endoplasmic reticulum. It catalyzes the addition of β-linked GlcNAc on Ser or Thr of EGF repeats. Mutations in EOGT gene reportedly result in genetic heterogeneity of Adams-Oliver Syndrome.

Sequence

Synthetic peptide located within the following region: GHHPTLGEHPKFTNYSFDVEEFMYLVLQAADHVLQHPKWPFKKKHDEL

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 3

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable


Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Joshua F Alfaro et al.
Proceedings of the National Academy of Sciences of the United States of America, 109(19), 7280-7285 (2012-04-21)
O-linked N-acetylglucosamine (O-GlcNAc) is a reversible posttranslational modification of Ser and Thr residues on cytosolic and nuclear proteins of higher eukaryotes catalyzed by O-GlcNAc transferase (OGT). O-GlcNAc has recently been found on Notch1 extracellular domain catalyzed by EGF domain-specific OGT.
Ranad Shaheen et al.
American journal of human genetics, 92(4), 598-604 (2013-03-26)
Adams-Oliver syndrome (AOS) is a rare, autosomal-dominant or -recessive disorder characterized primarily by aplasia cutis congenita and terminal transverse limb defects. Recently, we demonstrated that homozygous mutations in DOCK6 cause an autosomal-recessive form of AOS. In this study, we sought
Reto Müller et al.
PloS one, 8(5), e62835-e62835 (2013-05-15)
The O-GlcNAc transferase Eogt modifies EGF repeats in proteins that transit the secretory pathway, including Dumpy and Notch. In this paper, we show that the Notch ligands Delta and Serrate are also substrates of Eogt, that mutation of a putative

Questions

Reviews

No rating value

Active Filters

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service