AV35259

Anti-P2RX2 (AB1) antibody produced in rabbit

IgG fraction of antiserum

• Synonym(s): Anti-Purinergic receptor P2X, ligand-gated ion channel, 2
• UNSPSC Code: 12352203
• NACRES: NA.41

Properties

• biological source: rabbit
• Quality Level: 100
• conjugate: unconjugated
• antibody form: IgG fraction of antiserum
• antibody product type: primary antibodies
• clone: polyclonal
• form: buffered aqueous solution
• mol wt: 42 kDa
• species reactivity: human
• concentration: 0.5 mg - 1 mg/mL
• technique(s): immunohistochemistry: suitable; western blot: suitable
• NCBI accession no.: NP_733782
• UniProt accession no.: Q9UBL9-5
• shipped in: wet ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... P2RX2(22953)

Description

General description

P2RX2 (P2X2) is a purinoceptor that functions as an ATP-gated ion channel. The ectodomain movements of this receptor have been analyzed using disulphide locking. In propyl-methanethiosulfonate-attached P2X2 receptors; lipid intercalation can be facilitated between the transmembrane domains during channel opening.
Rabbit Anti-P2RX2 antibody recognizes human and bovine P2RX2.

Immunogen

Synthetic peptide directed towards the middle region of human P2RX2

Application

Rabbit Anti-P2RX2 is suitable for western blot (0.6 μg/ml) and IHC (4-8 μg/ml) applications.

Biochem/physiol Actions

P2RX2 belongs to the family of purinoceptors for ATP. This receptor functions as a ligand-gated ion channel. Binding to ATP mediates synaptic transmission between neurons and from neurons to smooth muscle. Six transcript variants encoding six distinct isoforms have been identified for this gene.

Sequence

Synthetic peptide located within the following region: LIKNSIHYPKFHFSKGNIADRTDGYLKRCTFHEASDLYCPIFKLGFIVEK

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Safety Information

• Storage Class Code: 10 - Combustible liquids
• WGK: WGK 1
• Flash Point(F): Not applicable
• Flash Point(C): Not applicable