Skip to Content
Merck
All Photos(3)

Key Documents

AV31464

Sigma-Aldrich

Anti-OLIG2 Antibody

rabbit polyclonal

Synonym(s):

Anti-BHLHB1, Anti-OLIGO2, Anti-Oligodendrocyte lineage transcription factor 2, Anti-PRKCBP2, Anti-RACK17

Sign Into View Organizational & Contract Pricing

Select a Size

100 μL
3.490,00 kr.

3.490,00 kr.


Please contact Customer Service for Availability


Select a Size

Change View
100 μL
3.490,00 kr.

About This Item

UNSPSC Code:
12352203
NACRES:
NA.41

3.490,00 kr.


Please contact Customer Service for Availability

Product Name

Anti-OLIG2 (AB2) antibody produced in rabbit, affinity isolated antibody

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

32 kDa

species reactivity

rat, human, mouse, dog, guinea pig, horse

concentration

0.5 mg - 1 mg/mL

technique(s)

immunohistochemistry: suitable
western blot: suitable

NCBI accession no.

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... OLIG2(10215)

General description

OLIG2 is a basic helix-loop-helix (bHLH) transcription factor that is expressed in the spinal cord. This transcription factor is involved in the development of oligodendrocytes and motor neurons. OLIG2 may be useful as a diagnostic marker of oligodendroglial cancer.
Rabbit Anti-OLIG2 (AB2) antibody recognizes chicken, human, mouse, rat, and bovine OLIG2.

Immunogen

Synthetic peptide directed towards the N terminal region of human OLIG2

Application

Rabbit Anti-OLIG2 (AB2) antibody is suitable for use in western blot applications at a concentration of 1μg/ml.

Biochem/physiol Actions

OLIG2 is a basic helix-loop-helix transcription factor which is expressed in oligodendroglial tumors of the brain. OLIG2 is an essential regulator of ventral neuroectodermal progenitor cell fate. It is associated with T-cell acute lymphoblastic leukemia due to a chromosomal translocation t(14;21)(q11.2;q22). OLIG2 might play a role in learning deficits associated with Down syndrome.This gene encodes a basic helix-loop-helix transcription factor which is expressed in oligodendroglial tumors of the brain. The protein is an essential regulator of ventral neuroectodermal progenitor cell fate. The gene is involved in a chromosomal translocation t(14;21)(q11.2;q22) associated with T-cell acute lymphoblastic leukemia. Its chromosomal location is within a region of chromosome 21 which has been suggested to play a role in learning deficits associated with Down syndrome. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Sequence

Synthetic peptide located within the following region: MDSDASLVSSRPSSPEPDDLFLPARSKGSSGSAFTGGTVSSSTPSDCPPE

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 3

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable


Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Qiao Zhou et al.
Cell, 109(1), 61-73 (2002-04-17)
OLIG1 and OLIG2 are basic-helix-loop-helix (bHLH) transcription factors expressed in the pMN domain of the spinal cord, which sequentially generates motoneurons and oligodendrocytes. In Olig1/2 double-mutant mice, motoneurons are largely eliminated, and oligodendrocyte differentiation is abolished. Lineage tracing data suggest
Y Marie et al.
Lancet (London, England), 358(9278), 298-300 (2001-08-11)
OLIG2 is a recently identified transcription factor involved in the specification of cells in the oligodendroglial lineage. We investigated the expression of OLIG2 by in-situ hybridisation in 21 brain tumours: nine grade II and III oligodendrogliomas, three grade II oligoastrocytomas

Questions

Reviews

No rating value

Active Filters

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service